SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011574 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011574
Domain Number 1 Region: 152-340
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.07e-29
Family Pentraxin (pentaxin) 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011574   Gene: ENSTGUG00000011229   Transcript: ENSTGUT00000011699
Sequence length 353
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:26060854:26065501:-1 gene:ENSTGUG00000011229 transcript:ENSTGUT00000011699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDYELMYVNLDNEIEGPAPATEEAASCDCQREHSKWDKLFIMLENSQMKENMMLQAVDEL
PRVELQTLKAELSQLATSLAGTLATVTSQAVSQVEQALARSREQAEEARRLQESERGKVL
EHVLQLSHNVRAALNKLCPRCAHTNKPTLSCETAILFPMRSRKIFGSVHPTSGMTLSSFT
ACIWLKVTEALDKTIVFSYGTRFNPYEIQLYLSRAAAVLAVGSAQHRLAAPNVVVPGKWL
HLCGTWSSENGSAALWAQGELAASAWDVAGAHTIPDGGILQLGQEKNGCCVGGGFDESLA
FSGKLTGFNLWDRVLSAAEVTAQSAGDSCGTRGNVVGWGVTEVLPYGGAQYVS
Download sequence
Identical sequences H0ZLV1
ENSTGUP00000011574 ENSTGUP00000011574 59729.ENSTGUP00000011574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]