SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011584 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000011584
Domain Number - Region: 66-273
Classification Level Classification E-value
Superfamily Tropomyosin 0.00163
Family Tropomyosin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011584   Gene: ENSTGUG00000011239   Transcript: ENSTGUT00000011709
Sequence length 276
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:26156266:26183796:-1 gene:ENSTGUG00000011239 transcript:ENSTGUT00000011709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRGPVHALPEEIRKMSREQTVCKYCGVSYLTLHEFKVMEDKVRAMEKEIKVYKGSLER
EQRLQAELQALHHDLERCRAESESKTERIKTLTVELKTKQEEMKTVKADLQYFQEEKEAA
YKQSQVLRTTLEHHCSTLNKAVSLFPFIRSELDSIKEVISTNMENFAAMKEEIFRQIKAM
SKEALTEIPKLNQRLAKSQRENECLQEKVKHLTEVADTVELKTQQLQTSLQQGNELQSRC
RELQKETLDLTNQVETAGLQLQKVTAEMEHYKKLLL
Download sequence
Identical sequences H0ZLW1
59729.ENSTGUP00000011584 ENSTGUP00000011584 ENSTGUP00000011584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]