SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011594 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011594
Domain Number 1 Region: 2043-2136
Classification Level Classification E-value
Superfamily C-type lectin-like 1.03e-32
Family Link domain 0.00015
Further Details:      
 
Domain Number 2 Region: 820-977
Classification Level Classification E-value
Superfamily FAS1 domain 1.7e-28
Family FAS1 domain 0.0022
Further Details:      
 
Domain Number 3 Region: 407-544
Classification Level Classification E-value
Superfamily FAS1 domain 4.58e-28
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 4 Region: 1427-1575
Classification Level Classification E-value
Superfamily FAS1 domain 9.55e-25
Family FAS1 domain 0.0026
Further Details:      
 
Domain Number 5 Region: 1587-1728
Classification Level Classification E-value
Superfamily FAS1 domain 1.96e-21
Family FAS1 domain 0.0039
Further Details:      
 
Domain Number 6 Region: 985-1111
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-21
Family FAS1 domain 0.0046
Further Details:      
 
Domain Number 7 Region: 227-393
Classification Level Classification E-value
Superfamily FAS1 domain 9.16e-21
Family FAS1 domain 0.0012
Further Details:      
 
Domain Number 8 Region: 2134-2297
Classification Level Classification E-value
Superfamily FAS1 domain 5.89e-20
Family FAS1 domain 0.0094
Further Details:      
 
Domain Number 9 Region: 1365-1403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000525
Family Merozoite surface protein 1 (MSP-1) 0.098
Further Details:      
 
Domain Number 10 Region: 1931-1967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000368
Family Merozoite surface protein 1 (MSP-1) 0.096
Further Details:      
 
Domain Number 11 Region: 1320-1373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000418
Family EGF-like domain of nidogen-1 0.085
Further Details:      
 
Domain Number 12 Region: 629-757
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000863
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000011594
Domain Number - Region: 124-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000112
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 1976-2010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000763
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 1231-1361
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00151
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number - Region: 769-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00562
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 1853-1890
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0237
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 1-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0347
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 164-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0359
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011594   Gene: ENSTGUG00000011216   Transcript: ENSTGUT00000011719
Sequence length 2384
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:54724992:54792189:-1 gene:ENSTGUG00000011216 transcript:ENSTGUT00000011719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPGGAASPCNGRGRCSQGIAGNGTCTCQKGFGGTACEKCAEDNLFGPDCTSVCDCVHGVC
NSGIAGDGSCTCLSGYKGLRCDEPIAECAALRCPANSRCAASAEDGTQLQCTCLPSFHGD
STRCEPINPCSRKVCDPNADCIYLGPNQHKCTCGEGYTGDGQICLPIDPCQAAHGSCPAH
SSICIYDGPGKSHCECKEHYTNFVPGKGCSMMDNCETNNTCHKKAKCLTVAPGQIACTCQ
EGSVGNGFVCYGNIMERLQDLNAEVGGQWQGKLTSSLLLMENSYEWQLSTLGPFTVLVPT
NKGLKGTNVKDLLKNKQKAQYFVKLHIIAGQLNTSSLNNANVIYTLTGKSGEISKGEKDN
QLRIRIQGGRGKGKILQGDIIASNGILHIIDKAMDNMEPTFESSNEKTIMSVLQANRRYS
QFASLIEKTGLGMDLQQDNQPYTVFVPSNKALSNMKAEVLDYLLSAKGSWKLLELVRYHI
VSNTELEVASLVSIEHIRTMAKQFIHFNRSSTGQILVSGEKMEETDIVAKNGRIYILEGV
LIPPTIVPILPHWCEETSQRSSGIGTSALCYTNAFCCKGFFGPNCRPCPGGFSKPCSGNG
QCMDGLDGNGTCVCSEAFQGLSCQLCSDPGKYGPQCDKECLCIYGKCDNRIDSDGTCLPG
SCRAGYTGSLCEQQIVPCEASLQLCHADADCQLSDGTVSCVCKPGYEGDGLSCSKVDPCA
VLNPGGCNINAECVQTGPGEHRCVCQAGWTGDGRDCSAINNCLLPSTARCHENATCIYIG
PAQNDCKCKDGFQGNGIECTPINSCLEQNGKCHHLATCQFVSSRGWECVCPEGYEGDGRT
CYGNAADELSTLSEAAAFNQWVNEAKINSVLSTTSNLTVLVPSLQAIENMDEDEKAFWMS
KSNIPTLLKYHVLTGAYSFADFQNLSSSDMLPTSLQSKFLHLSKENGNLTLEGAHFVASD
IASTNGVIHVIDKVLTPLRSAVMPRLLARLEQMPDYSIFRGYIIQYSLANEIEAANTYTV
FAPSNDAIENYLKDKKSATLDEGQIRYHIVLDEKLLKNNLHNGMHRETMLGFSYQVGFFL
HNSQLYINDAPISYANVATDRGIIHGLGKVLEIQKNRCDTNSTVIIEKCRICSQPSSCPP
GTKEIVRVKKYCVLTENHMRQYTIQIGCKPKCAKTIINRECCAGFFGPQCQACPGRAGSA
CSGNGVCLDGINGTGSCQCDRGFEGTACESCSPGRYGRSCDQNIVCTCVHGKCSSGVDGD
GSCECDVGWRGVTCDTEIKDDACNASCHTSANCLLLSNGTAYCKCAAGFEGNGTFCTGNS
IDACESSNGGCSSKAECRRTTPGNRACVCSAGYTGDGIVCIEINPCLMNNGGCDRNAECT
QTGPNQAVCNCLKGYSGDGKTCTYISLCSQNNGGCSEFAICNDTELTERTCTCKPNYIGD
GFKCRGNIFQELLRNSNTSRFYFHLEALSIRDISGPGPFTLFVPHTDVLNSDPRVKDWVA
KGVMAQVLRYHVVGCASLLYKDLAAITNVTSLQGDLIHISYSQNSLVLNNKAEIVLSDAV
GTNGVIHVINQILVPSHMQDFPLKKVCESLKMVAAKHGYILFNTLLEKNNLLGLINDPIH
KPVTLFWPTDTAIRGLPQEQQDFLFKKSNTNKLVQYLKFHIVRDAAVLAYQLQSSTSLKT
LQGSNLSVSCGDNGEIGALFLNDGQCKVVQRQLEFDGGIAYGINCLLTEPSLGGRCDSFL
TMEFMGHCASCFNNYKCPPGTKPKEGMQWCTYESYGLRRDGCRRNCSMVIHIAKCCKGYF
GPDCQACPGGPETPCNGHGSCDDGYTGTGECRCTGGFNGTSCELCLPGRYGFTCRPCECK
NNGQCDEGYSGTGRCFCETGWTGRLCETKLALPPVCSPSCSANAVCTENNTCQCKPLYDG
DGITCTAAELCKQNNGGCHKAADCTQHGVKVFCSCQKGYKGDGFTCLPINPCADGFNGGC
HEHAICTVTGPGRRKCECKINYIGDGLNCSVMQLPLDRCLQDNGQCHPDADCADLHFQDT
TVGVFHLQSPVGQYRMSYEQAKEACANESATIATYDQLLYAQKARYQLCSAGWLDGGRVG
YPTAFSSPNCGSGHVGIVDYGRRVNLSETWDTFCYREKEVNCTCKPGYVGDGISCSGNLL
QVLMSFPTLTNFLSDIMAYSNTSRKGREFLQYLTDLSVHATLFAPIDSGLKENETLSGRD
IEYHLSNANIMFYEDLTNGTTLLTRLGKKLLITNTGGQEHRISTADQIRYVDRSAIVEWD
IIASNGIIHIISEPLKAPSEPAPLHASAGTGIFFGICLVTGIVALVGYSYLRFRKKNFGF
QHFKSKDDTDTTSLDKSQPSNITNPSYESSSTLTSPEPAYDLFS
Download sequence
Identical sequences H0ZLX1
ENSTGUP00000011594 59729.ENSTGUP00000011594 ENSTGUP00000011594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]