SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011632 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011632
Domain Number 1 Region: 11-89
Classification Level Classification E-value
Superfamily BT0923-like 0.0000379
Family BT0923-like 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000011632
Domain Number - Region: 56-168
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000785
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011632   Gene: ENSTGUG00000011280   Transcript: ENSTGUT00000011759
Sequence length 192
Comment pep:novel chromosome:taeGut3.2.4:1:45872180:45877563:-1 gene:ENSTGUG00000011280 transcript:ENSTGUT00000011759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEIERETAYPDGKVEKVLKNGCHLIFFPNGTWKKVGSDGKTVTITFFNGDVKQIMPDQTV
IYYYADAKTTHTTYSNGLEVLQFSNGQIEKHYPDGKKEITFPDQTIKSLFSDGQEESIFP
DGTIVRVQRDGTKTIEFNNGQRELHTSQFKRREYPDGTVKTVYMNGQQETKYVSGRVRVK
DKDGNIIMDTKL
Download sequence
Identical sequences H0ZM09
59729.ENSTGUP00000011632 ENSTGUP00000011632 ENSTGUP00000011632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]