SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011635 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011635
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily Chromo domain-like 3.05e-19
Family Chromo domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011635   Gene: ENSTGUG00000011292   Transcript: ENSTGUT00000011762
Sequence length 209
Comment pep:novel chromosome:taeGut3.2.4:1:45912815:45917983:1 gene:ENSTGUG00000011292 transcript:ENSTGUT00000011762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEEEEDVFEVEKILDMKNEGGKTLYKVRWKGYTSDDDTWEPEAHLEDCKEVLLEFRKKIV
DNKPKPVKKEIQKPPLNDDIFEAESDSDLQSETKDDVSPKKKKKKSKEGEDKSPDDVKKK
KSKSAKLKEKPRTECENSSDTLVLDSKPKKRTSETKEDSKDPKKQRKEDTKEIKKKKGDD
LKIKSKEDSKENKKSQKEKHGDVQLDSES
Download sequence
Identical sequences H0ZM12
ENSTGUP00000011635 59729.ENSTGUP00000011635 ENSTGUP00000011635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]