SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011661 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011661
Domain Number 1 Region: 143-293
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-34
Family Pleckstrin-homology domain (PH domain) 0.00000584
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-23
Family Pleckstrin-homology domain (PH domain) 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011661   Gene: ENSTGUG00000011311   Transcript: ENSTGUT00000011788
Sequence length 390
Comment pep:known chromosome:taeGut3.2.4:6:31772498:31787602:1 gene:ENSTGUG00000011311 transcript:ENSTGUT00000011788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTQEDSLVWYMDNPQNLPSGSPPVGCIK
LTYISKVSDATKLRPKAEFCFVMNAGMRKYFLQANDQQDLVEWVNVLNKATKITVPKQSD
PLCQVDNANRQAESPGGKKQVSYRTEIVGGVPIITPTQKEEVSEGSEGADRNYLKRSQSH
LPYFAAKHPPDNAIIKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLK
EVHKVQECKQSDIMMRDNLFEIVTTSRTFYVQADSPEDMHSWIKAISGAIVAQRGPGRSA
ASMRQARRLSNPCIQRSIPSLLPNPAMLSVLPAQPQPAHIPQPLAAALWSQPLTPNPLPW
RSEDFTSLLPRPSQGATRSRLSLQENQLPK
Download sequence
Identical sequences H0ZM38
ENSTGUP00000011661 ENSTGUP00000011661 59729.ENSTGUP00000011661 XP_012430174.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]