SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011684 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011684
Domain Number 1 Region: 5-111
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-35
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011684   Gene: ENSTGUG00000011333   Transcript: ENSTGUT00000011811
Sequence length 396
Comment pep:novel chromosome:taeGut3.2.4:6:31862406:31918768:1 gene:ENSTGUG00000011333 transcript:ENSTGUT00000011811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGGLLSSSSGTLQSPFYPRNYPNNANCVWEIQVKSNFRVTIEFTDIQMEGGRCLSDYVEI
YDGPLQTSPLLGKICSGYYPSYTSSSNLMSVRFHSDSRYTYRGFQANYYSTPADDSTTLL
CLPDYMHVVVSRYFLESHGYSAWNLTLNDPFCTPNITSNSVSFDIPYTRCGTVREGNNET
ITYSNVIKVPAPGRVIKRQKDLHLHISCKMLQNTWVQVMYIADDVIDVNKTQYGRYDVSL
TFYNSSSFQWPVHDFPYYVDMNQNLFLQASLHSSDQNLTVFVDTCVASPNSSDFRTLVYE
LTKSGCPRDSSYATFYSPSSHFARFKFNAFEFMSRHPSVYLKCRMLVCRLGDFSSRCYRG
CSSRAKRDTSPAEEHVDVVLGPLQLRGGDAPSGTTG
Download sequence
Identical sequences H0ZM61
ENSTGUP00000011684 ENSTGUP00000011684 59729.ENSTGUP00000011684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]