SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011693 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011693
Domain Number 1 Region: 692-856,906-1046
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-78
Family Protein kinases, catalytic subunit 0.00000314
Further Details:      
 
Domain Number 2 Region: 102-142
Classification Level Classification E-value
Superfamily UBA-like 2.69e-18
Family UBA domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011693   Gene: ENSTGUG00000011347   Transcript: ENSTGUT00000011820
Sequence length 1137
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:57241590:57256208:1 gene:ENSTGUG00000011347 transcript:ENSTGUT00000011820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSEKPEGYRQMRPKTFPASNYTGSSQQMLQEIRESLRNLPKPSDAAKADHSMGKMLPE
DPRQGRNPPKFVTYHKVLQEIRNSLLPFANEATSAVKGTSEVNRQMLQDLQAAGFDEDMV
IQALRQTNNRSIEAAIEFISKMSYQDPRREQMVAAAARPVNAGMKPPGAVQQSVHRKQSW
KGSKESLVPQRHGPSLAEGVIYRSESPSSQPDVGRPLSGSGIAAFAQAHPANGQRVNPPP
LPQIRSVTPPPPPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGNMEYMISRISPVPPGTWQ
DGYPPPPMNPPPMNSSTQGQRGMSAVPIGRQPIIMQSSANSKFSFPSGRAGMQNGNCQSE
FIVHQNVVSGNSVSRQPPPYPMNPTNRQSPTALQMQAGGSAPPSAYTNGNIPQAIMVPNR
NSHNLELYNTNVAGIPASWSQPSPVQPQSSPGNGHDMPAWQPSIPVRSNSFNNHHGSRQS
HSGSSQPSATTVTAITPAPIQQPVKSMRVLKPELQTALAPTHPSWMPQPVQTVQTIPFSD
SPSTNMAVMSPVAEAPNYQGPPPPYPKHLLHQTPSVNLYEAGPKLNKEEPPPLSREDENE
KNYECVDSTDKEKKQITTSPVPVRKNKKDEERRESRIQSYSPQAFKFFMEQHVENILKSH
QQRLHRKKQLENEMMRVGLSPEARDQMRKMLCQKESNYIRLRRAKMDKSMFVKIKTLGVG
AFGEVCLARKVDTNALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQD
KDNLYFVMDYIPGGDMMSLLIRMGVFPENLARFYTAELTCAVESVHKMGFIHRDIKPDNI
LIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHARQDSMDFSSEWGDPANCRCGDRLKPL
ERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWVGVILFEMLVGQPPFLAQTP
LETQMKVINWQTALHIPPQAKLTPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDF
SSDLRRQPAFYIPKIAHPTDTSNFDPVDPDKLWSDDDKEGNRNDTLNGWYKNGKHPEHAF
YEFTFRRFFDDNGYPYNNPKPIEYEYGSSQNSEQQSDDDDDDEQASRVVQSRDLVYV
Download sequence
Identical sequences H0ZM70
59729.ENSTGUP00000011693 ENSTGUP00000011693 ENSTGUP00000011693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]