SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011768 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011768
Domain Number 1 Region: 176-507
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.27e-67
Family Pancreatic carboxypeptidases 0.00000197
Further Details:      
 
Domain Number 2 Region: 2-161
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.03e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 507-590
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.41e-19
Family Carboxypeptidase regulatory domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011768   Gene: ENSTGUG00000011397   Transcript: ENSTGUT00000011897
Sequence length 619
Comment pep:novel chromosome:taeGut3.2.4:6:32351895:32397518:-1 gene:ENSTGUG00000011397 transcript:ENSTGUT00000011897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPPLGLETLKITDFQLHASTAKRYGLGAHRGRLNIQAGVNENDFYDGAWCAGRNDPYQWI
EVDARRLTKFTGVITQGRNSLWSSNWVTSYRVLVSNDSHAWTAVRNESGDVIFEGNSEKE
IPVLNMLPVPLVARYIRINPRSWFQEGSICMRLEILGCPLPDPNNYYHRRNEMTTTDNLD
FKHHNYKEMRQLKTVNKMCPNITRIYNIGKSNQGLKLYAVEISDNPGEHEVGEPEFHYIA
GAHGNEVLGRELILLLMQFMCQEYLAGNPRIVHLIQDTRIHLLPSVNPDGYDKAYKAGSE
LGGWSLGRWTQDGIDINNNFPDLNSLLWESEDQKKSKRKVPNHHIPIPDWYLSENATVAV
ETRAIIAWMEKIPFVLGGNLQGGELVVAYPYDMVRSMWKTQDYTPTPDDHVFRWLAYSYA
STHRLMTDARRRACHTEDFQKEDGTVNGASWHTVAGSINDFSYLHTNCFELSIYVGCDKY
PHESELPEEWENNRESLIVFMEQVHRGIKGIVKDVHGKGIPNAVISVEGVNHDIRTGADG
DYWRLLNPGEYVVGVKAEGYTTATKTCEVGYDMGATQCDFTISKTNLARIKEIMRKFGKQ
PLGLSARRLRQRARRWQQR
Download sequence
Identical sequences H0ZME5
ENSTGUP00000011768 59729.ENSTGUP00000011768 ENSTGUP00000011768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]