SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011769 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011769
Domain Number 1 Region: 4438-4564
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 1.26e-22
Family HEPN domain 0.0048
Further Details:      
 
Domain Number 2 Region: 79-276
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.33e-21
Family DNA gyrase/MutL, N-terminal domain 0.084
Further Details:      
 
Domain Number 3 Region: 1439-1627
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.02e-18
Family Heat shock protein 90, HSP90, N-terminal domain 0.035
Further Details:      
 
Domain Number 4 Region: 2510-2637
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.29e-16
Family Heat shock protein 90, HSP90, N-terminal domain 0.056
Further Details:      
 
Domain Number 5 Region: 4295-4364
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000017
Family Chaperone J-domain 0.0000374
Further Details:      
 
Domain Number 6 Region: 2-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000372
Family Ubiquitin-related 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011769   Gene: ENSTGUG00000011419   Transcript: ENSTGUT00000011898
Sequence length 4568
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:47535799:47567201:-1 gene:ENSTGUG00000011419 transcript:ENSTGUT00000011898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVTVLHDCLGCRTFELPPSAAVRDVKRIEAEAGLPAAEQRLWHRGRELSDAIKIGDLQKS
QNQVFLELQSKGLKGGGRFGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVR
FLYDETQYGTETLWSKDMAQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRF
GIGFNSVYHITDVPSIFSGDQIGMLDPHQTLFGPHESGQCWNLKEDSKEINELTDQFAPF
IGVFGSTKETFKNGNFPGTFFRFPLRLQPSQLSSNVYDKQKVLELFESFRTDADTVLLFL
KSVQDVSLHVREADGTERLVFRVTASENKALKHERPNSIKILGTAINQYCKGVPSNSITC
VTYHVNIVVEDESVKDAQKTSWLVCNCVGGRGMCTELDCLADDLKFVPTIGIAMSLAANE
EENGAVADFSGRAFCFLPLPPGEESKTGLPVHVSGFFGLTDNRRSIKWRELDQWRDPAAL
WNDLLVVNIVPKAYTTLILEAIKRMETEKNSDFPLSPERIYRLWPDENKIRVPWKPIVVP
LFKDLLQHPVIYSVSNQWIKVEQVYFSEMDESLEYTQSVLNYLQNSGKQIAKVPANIANA
VHLTISTSKAVKKVTPAVVRQVLRKSGHSGPAEEKLNLLEFVLSDGVYSELIGLELLPLQ
NGSFIPFSSSVSEQDVVYITSEEYPRSLFPGLEGRLLSDDLKPEVLAALKEAAKSRGRPC
TQLQLLNPERFARLVKEVMNSVWPGRDVVVQWYPGLEEKKHPSVSWLKMVWKNLYIHFSD
DLSVFDEMPLIPRTLLEENQTSVELVRFKNPSPIILEDESETQLPEYLADIIQKIGGVVL
KKLDISIQHPLIKKYVHPPLPSAVLQIMEKMSLQKLCNQVASFPPTHKDALRAFLASLTD
ANEKEKRIIQELLMFKKVEKSSDESVPVYTGLNGSKVLHHTAKIPPGLRFSVPIIDSSDE
ATIRLANLLKIEQLKSTDCLKFVIEDIRSDFYSYDETAQIMQWVLENLTFLKNENTDVID
WLTPLKFIQISPEKIVSANELFDPEVELLQHLFYAEEESCFPPVIFTSDILHSLRQIGLK
NEANLEENDILRVAKKIESLHADSNTNHDLLLRKARTLLTILNKNHMLLQSSETKATMKK
IKWIPASKERPPNYPGSLVWKGDHCNLCSPPEMCDISHAILVGSSVPLVENVVLDIEKAL
GIPTKPSIKAVLKHFKVVVDWHGSKTFSDEDYYQFQHILLEIYGFMHDHLEEGKEAFKSL
KFPWVWTGKTFCSLAQAVIKSVPDLDLQPYLHYVPKTMAKFHQLFKCCGSIEELTPDHVS
MVIQKIYLKSEQSLSEQESKQSLHIMLSIIRWLYSNQIPASLHTPMPLYSGKLPYKLAMK
PIHECCYCDIKVDDLNDLLEDSVEPIILVHEDIPMKTAEWLNVPCLSTRLINPENMGFEQ
SGQREPLTVRIKNILEEYPSISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPG
MAACHGPALWSFNNSEFSDSDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIIL
SREFMIMFDPNVNHISKHIRDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTV
ESPYSYKGTLFRLSFRTQQEAKVSEVSSASYNTADIYSLVDEFSICGHRLIIFAQSVNSM
VLKYLKIEADDPGVAQDVVTIRKNLCSSKALTAPNVSVLKEAAKLMKVCSSSTKKLPTEA
PKSSCILQIVVEEFHHVFRRIADLQSPLFRGTEDDPTAFFEMAKSGQTKRSGDELPQKTV
DSTTWLICSCMDVGDALKFSLHESGRRLGLVPCGGVGVLLSETQDQKWIVKPNCNNIGEV
FCYLPLRIKTGLPLHINGCFAVTSNRKEIWKTDTKGRWNTVFMRHVIVKAYIEALCVLRD
MAINGELVDYSYCAVWPDPDSVHDDFSVICQGFYEDIAHMKSKEGIKVFSDGSSWVSMKN
VRFLDDSILKRPDVGPSAFKIFLKYLKKTGSKNLCAVDLPSWVKTGFEEAGCKYILLENT
FSEKQFFSEVFFPNIQEIDAELRDPLMRYVLNEKVEEFSGILRATPCIPCSLDGHSLVTP
SRLIHPEGRVAKLYDAEDGRFPYGTTQDYLNPVILVKLVQLGMAKDDILWEDLIERAESV
AEINKTDHAAACLRSSIILSLIDEKLKSRDPRAKEFAAKCQNIPFLPFLSKPAGFSLHWK
GSDFQPEAMFSANDLFTADHQDIVCLIQPILNENSHSFKGCGTLSLAVKEFLGLLKKPAV
NLVINQLEEVAKSFDGITLYQENITNACYKYLHEAMLESESTKAMIIEQLTNSSFILVEN
VYADPSKVSFHLNFEAAPYLYQLPNKYKNSFRELFESVGVRQAFTVEDFAVVLELINQER
GTKQLTEDNFQLCRRIISEGIWGLIREKKQEFCEKKYGEILLPDTRLALLPAKSLCYNDC
PWIKVKDTTVKYCHGDIPREVAVKLGAIPKRHKALERYASNICFTTLGTEFGQKEKLTSR
IKSILNAYPSEKEMLKELLQNADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVY
NNQPFTEDDIRGIQNLGKGTKVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPH
ARYAPGSTSTSPGRMFRDLDADFRTQFSDVLDLYLGNHFKLDNCTMFRFPLRNGEMAKVS
EISSVPCSDRMVQNLLDKLRTDGAELLMFLNHMEKISICEVEKTTGALNVLYSVQGKITD
GDRLKRKQFHASVIDSVTKKKQLSEIPVQQITYTMDTEDSEGNLTTWLICNRSGFSAMEK
VSKSVVSAHKNEDITLFPRGGVAACITHNYKKPHRAFCFLPLSLETGLPFHVNGHFALDS
ARRNLWRDDNGVGVRSDWNSSLMTALIAPAYVELLIQLKKRYFPGTDPTVSVLQNTPIHA
VKDTLKKFLSFFPVNRLDIQPDWYCLVKAVYSCIYEDLKRLLPVMRAPNVDGSDLHSAVI
ITWVNMCAVNKGRPFFDNLLQDELQHLKNTEYNITTRKTVAENVYRLKHLLLEIGFNLVY
NCDETANLYHCLVDADIPVTYVTPADVRLFLMTFSFPDSNCHIGKLPCRLQQTNLKLFHS
LKLLVDYCFKDAEENEIQIEGLPLLITLDNVLQVFDSKRPKFLTTYHELIPSRKDLFMNT
LYLRYNNILLSSEVAKVFDIRSFAELLSSVLPREYKTRNCMKWKENFASESWLKSAWHFI
SESLNIKEEQEDTQAKFDGVIETLKDWTLLPGVKFTVSANHLVVPESDVLLPLSIMHIAV
FPNAQSDKVFHALMKTGCIQLALNKICSKDSALVPLLSGRTANIDNPSSILKAIQYMVQT
STFKTEKLAESDFEALLMYFNCNLCHLTSQDDIKILKSLPCYKSISGRYISIAKYGTCYV
LTKSIPSVEVDRWTQSTSSAFLEEKVHLKDLYTMLGCVSVDDLEVYLKHLLPKIESLSYD
AKLEHLIYLKNRLTSIEETSEMKEQLFEKLESILIIHDASNRLKPAKYFYDRTVKVFEVM
LPEKFFIPQDFFKKLEQLTKPKNQAAFLPSWVTFLRHIGLKFIISQQQLLQFAKEISMRA
NTENWSKETLQNTVDVLLHHIFQERADLFSGNFLKELSLIPFLCPERAPAEFVRFHPQYQ
EVNGTLPLIRFNGAQVNPKFKQTDVLQLLWTSCPILPEKATPLSIKEQEGSSLGAQEQLE
QVLAMLNVNLDPPLDKVINNCRNICNITTLDEDMVKTRAKVLRSIYEFLSTEKREFRFQL
RGVSFVMVEEGWKLLKPEEVVINLEYESDFKPYLYKLPLELGTFHQLFKHLGTEDIISTK
QYVEVLGRIYKSSEGKQLDPNEMRTVKRVVSGLFKSLQNDSVKVRNDLENMRDFALYLPS
QDGRLVKSSILVFDDAPHYKSRIQGNIGVQMLVDLSQCYLGKDHGFHTKLIMLFPQKLRP
RLLSSILEEQLDEESPKICQFGALCSLQGRLQLLLSSEQFITGLIRIMKHENDNAFLANE
EKAIRLCKALREGLKVSCFEKLQTTLRVKGFAPIPHSKSETFAFLKRYGNAVILLYIQHS
DSKDINFLLALAMTLKSATDNLISDTSYLIAMLGCNDIYRISEKLDSLGVKYDSSEPSKL
ELPTPGTPIPAEIHYTLLMDPMNVFYPGEYVGYLVDSEGGDIYGSYQPTYTYAIIVQEVE
REDDESPSFLGKIYQIDIGYSEYKIVSSLDLYKFSRPEESSQGRDSTPSTPTSPTEFPAH
GPRAIPPIFTGRESHKTMSSKHHSPKKIKSNSLPEILKEVTSVIEQAWKLPESERKKIIR
RLYLKWHPDKNAENLDIANEVFKHLQNEINRMEKQAFMDQNMDRASRRPFSSSASRFQSD
KFSFQRFYTSWNQEATSHKSERQQYKEKCPSSTGPSYSQRFFVPPTFRSVGNPVEARRWL
RQARANFSAARNDLHKNANEWVCFKCYLSAKLALIAADYAVKGKSDKDIKPAALAQKIEE
YSQQLEGLSNDVQTLEAYGVDSLKTRYPDLLPFPQIPNDRFTSEVAMRVMECTACIIIKL
ENFIQQKV
Download sequence
Identical sequences H0ZME6
ENSTGUP00000011769 59729.ENSTGUP00000011769 ENSTGUP00000011769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]