SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011784 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011784
Domain Number 1 Region: 40-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000389
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011784   Gene: ENSTGUG00000011438   Transcript: ENSTGUT00000011913
Sequence length 293
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:27114442:27164078:-1 gene:ENSTGUG00000011438 transcript:ENSTGUT00000011913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHGMVASKSNTGSSLALTGHGLFHLLVFFGSFILEAQSTDCPQPPQPENGGYKCHPSPC
NNPLTSGSVIEYLCVEGYMLKGDYKYLTCKNGEWNPAMEVSCRLSPEKDSPPTIGVPTLS
IVASTASSVALILLLVVLFVLLQPKLKSFHHSRRDQGVSGDQVSIMVDGVQVALPSYEEA
VYGSTGNCIPPSDSRVQIVLSEGAGQNGPREMQQPDQGAHNTFEREDEAPGHSGLCEASG
SQRSETVLVHQAATSSWVAGMASSRPVHKEVQDSESSDIQSLLSLTSSEEYTD
Download sequence
Identical sequences H0ZMG1
59729.ENSTGUP00000011784 ENSTGUP00000011784 ENSTGUP00000011784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]