SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011835 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011835
Domain Number 1 Region: 546-789
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.71e-80
Family Eukaryotic proteases 0.000000275
Further Details:      
 
Domain Number 2 Region: 351-445
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-39
Family Kringle modules 0.0000324
Further Details:      
 
Domain Number 3 Region: 256-343
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-36
Family Kringle modules 0.0000319
Further Details:      
 
Domain Number 4 Region: 73-166
Classification Level Classification E-value
Superfamily Kringle-like 1.3e-34
Family Kringle modules 0.0000769
Further Details:      
 
Domain Number 5 Region: 457-545
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-34
Family Kringle modules 0.0000683
Further Details:      
 
Domain Number 6 Region: 167-251
Classification Level Classification E-value
Superfamily Kringle-like 2.24e-34
Family Kringle modules 0.0000231
Further Details:      
 
Domain Number 7 Region: 2-83
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 5.49e-18
Family Hairpin loop containing domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011835   Gene: ENSTGUG00000011476   Transcript: ENSTGUT00000011964
Sequence length 791
Comment pep:novel chromosome:taeGut3.2.4:3:57766902:57787377:-1 gene:ENSTGUG00000011476 transcript:ENSTGUT00000011964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSTLDRYVRTEGAWLLNPMKQVYRANSDEECAEKCESEEKFPCRAFLFTSKDQQCLTLS
ENTKTAMIFRRANAVLYEKRIYLLECREGKGVDYRGTEAKTRKGVKCQKWADNSPHKPNY
TPEKYPKAGLEENYCRNPDQDEKGPWCYTTDPDTRFDYCNIPECEVECMHCSGENYHGVA
ATTESGLECQRWDSQQPHSHGYLPENFPEKDLKNNYCRNPDGEPRPWCFTTSPTKRWEYC
DIPRCTTPPPPPAPGRQCLSGRGEDYRGTVSVTESGNTCQHWSSQSPHRHARTPENYPCQ
SLDENYCRNPDGEKMPWCYTTNTTARWEYCNIPSCDSTKPEDPAVDVPEQAEVAEECYQG
NGVTYRGTASFTLSGKKCQAWSSMSPHRHNKTAKNFPNAGLSQNYCRNPDADSRPWCYTT
DPSVRWEYCDLKKCDGQGLQTVPKPPQTTQETNPVLETQGKCIIENGVDYRGTVAKTARG
RTCQEWSSQRPHSHDYFTPTTHPRAGLEKNYCRNPDGDVNGPWCYTTDPRKAWEYCDIPK
CPPPQYECGKSKFRPKLCAQRIVAGCVSHPHSWPWQISLRTSYGLHFCGGTLIDPQWVLT
AAHCLEKSSRPAAYKVYLGLHKEVATEPSVQIRDVEKLFKEPRRADIALLKLSRPAVINN
HVIPVCLPKENSVLGGREDCYVTGWGDTKGTRGAGYLKETGFPVIENKICNRPEFLNGRV
KNHELCAGNIHGGTDTCQGDSGGPLVCLDQDKFVQHGVTSWGLGCAQPMKPGVYVRVSNY
IPWIKSVMESN
Download sequence
Identical sequences H0ZML2
ENSTGUP00000011835 59729.ENSTGUP00000011835 ENSTGUP00000011835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]