SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011850 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011850
Domain Number 1 Region: 689-981
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-81
Family Protein kinases, catalytic subunit 0.000000000465
Further Details:      
 
Domain Number 2 Region: 21-181
Classification Level Classification E-value
Superfamily L domain-like 2.04e-45
Family L domain 0.000016
Further Details:      
 
Domain Number 3 Region: 299-491
Classification Level Classification E-value
Superfamily L domain-like 7.37e-45
Family L domain 0.00000251
Further Details:      
 
Domain Number 4 Region: 476-607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.01e-22
Family Growth factor receptor domain 0.00000318
Further Details:      
 
Domain Number 5 Region: 160-305
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.17e-18
Family Growth factor receptor domain 0.000000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011850   Gene: ENSTGUG00000011479   Transcript: ENSTGUT00000011979
Sequence length 1261
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:29615047:30007012:-1 gene:ENSTGUG00000011479 transcript:ENSTGUT00000011979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSIREVTGY
VLVALNQFEYLPLENLRIVRGTKLYEERYALAIFLNYRKDGNFGLRELGLRNLTEILNGG
VYVGQNKFLCFADTIHWQDIVRNPWASNFTLVPTNGSSGCGRCHKSCTGRCWGPTENHCQ
TLTKTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTF
VYNPTTFQLEHNHNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPC
TDICPKACDGIGTGSLVSAQTVDSSNIDKFVNCTKINGNLIFLVTGIHGDPYHTIAAINP
EKLNIFQTVREITGYLNIQSWPENMTDFRVFSNLVTIGGRALYSGLSLLILKQQGITSLQ
FQSLKQISAGNIYITDNSNLCYYHTVNWSSLFSTPSQKTVIHRNKKAENCTADGMVCNEL
CSSDGCWGPGPDQCLSCKRFIRGRTCIDSCNLYDGEFREFANGSVCVECDPQCEKMEENM
ITCYGPGPDHCTKCFHFKDGPNCVEKCPDGLQGANSFIFKYADEDRECHPCHPNCTQGCR
GPASHDCIFYPWTRQSTLPQHARTPLIAAGVIGGLFIIVIMGLTFAVYVRRKSIKKKRAL
RRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKI
PVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLD
YVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLAR
LLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPT
REIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLV
IQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRTRIDSNRN
QFVYRDGGYAAEVPMPYRAPGCILPEAPAAQGATAEIFEDTCCNGTMQKQVAALAKEDSS
TQRYSADPTVFMPERVVRGELDEDGYMTPMRDKPKTDYLNPVEENPFVSRRKNGDLQAVD
NPEYHKAPNGQPKAEDEYVNEPLYLNTFASTLENAEYLKNNLPEKAKKAFDNPDYWNHSL
PPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTV
V
Download sequence
Identical sequences H0ZMM7
ENSTGUP00000011850 ENSTGUP00000011850 59729.ENSTGUP00000011850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]