SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011857 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011857
Domain Number 1 Region: 414-479,520-617
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-31
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 
Domain Number 2 Region: 1037-1169
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-19
Family Second domain of FERM 0.0049
Further Details:      
 
Domain Number 3 Region: 625-744
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-18
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 938-1043
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000269
Family Ubiquitin-related 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011857   Gene: ENSTGUG00000011500   Transcript: ENSTGUT00000011986
Sequence length 1306
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:28193641:28231204:1 gene:ENSTGUG00000011500 transcript:ENSTGUT00000011986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMQELEQRVIEAEQRAEDAEKQVRVMEEKIKLADVKTGEFDSTLQKKYQELMCTMQGKED
LINKLETQLAKQKQLRTEEAKIVQEKAAKIKEWVTFKLRELELENYHLKNCNQRLMEQIE
ALQDTLQGKCVQLALQPSNHHKSGSWHSWQAVELLCSVVGSIFKMGITCLPALTLDFFSH
QQSTIQLGLDSTRFSDDLSARFHSHQLDSSSSAEIMSMLEGHLQTAEPPLVVSTSAVTAH
SFFPGRECSLGSSMTFPKIRAPNTPRDSIQLAKRHHSQPQSGANSFHRVMHLETSTFQPI
TDPPVGCGHVEETDIDDDGVMEKMETECGLLRGETGTCEGIEAVSSESGTLDPGCKPPTP
PLHRFPSWESRIYAVAKSGMRLSEVAMGNDTSSCFSNFSCSTSGPFTYLIYRNVTVPVYT
TLKGKATQISNVPFLDESSGSDDDCGSHASFRTSTAGCETRKASMPGSPRAVKRGVSVSS
LSSESDYAIPPDAYSLDGDYSEPEHKLQRTSSYSTDGGICSEPMEKSGYLLKMGSQVKAW
KRRWFVLRNRQIMYYKSPSDVIRKPQGQLELNSSCQIVRGEGSQTFQLVTEKRTYFLTAD
SPNILEEWIHVLQSILRVQVSSPVGVPHSDAKPTVKGWLTKVKHGHSKLVWCALIGKTFY
YYRNHEDKCPLGHLPLRDSKVEEVDRSCDSDEDYESTGGGLLSSHCTLAIHPQDQSPTYL
LIRTKQEKNTWLYHLTVAAGSSNATVGTSYEQLIGKLLDADGDPNSPLWKHPMLCYSKDG
LHTSLTTLPSEALQTEALKLFKSCQLFINVPVEASSIDYHVSLAQTALQVCLTHTELQNE
IYCQLVKQTSCRQPQNHSLIQCWQLLALCAPLFLPQHHFLWYIKQHLQRHADPRSEIGKY
AIYCQRSVARTVQAGEREAKPSRMEIVSILLRNPYHHSLPFSIPVHFMNGTYQVVGFDGS
STVDEFIQRLNQETGMRKPSHMGFSLFTDDPSGRNLEHCLPGNMKICDVISKWEQALKEL
HPGKYEGGTRIVKLTYKNRLYFRSQAKGETDRERLLLAFQVSNEIASGRFPVNKELALEM
VALMAQVEYGDLDRPGSSSPGGTSQLKMQHLLHQVLDKFYPKHYKQNITPEQLRQLTDRL
ATKWMVLQGCSPPECIRIYLTVARKWPLFGTKIFAAKPILPSSLDDCPVWIAVNEDGISI
LDYSTMHLKVSYSYSSVLTFGGCRDDFMIVVSKMKERSSGKNSTEKLLFTMAIPKIVEAT
LLIASYINYRSTPSLLSKTPAKKPWETENRCFFPSVPRSTKGPTLL
Download sequence
Identical sequences H0ZMN4
ENSTGUP00000011857 59729.ENSTGUP00000011857 ENSTGUP00000011857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]