SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011887 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011887
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.74e-34
Family Galectin (animal S-lectin) 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011887   Gene: ENSTGUG00000011536   Transcript: ENSTGUT00000012017
Sequence length 136
Comment pep:novel chromosome:taeGut3.2.4:5:28341648:28343174:1 gene:ENSTGUG00000011536 transcript:ENSTGUT00000012017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVEQYVGEIKGGLRPTMKLTVIGMVHSKPKSFSVTLLCDPVDANKDVGLLFTVNFSEKSI
TRNARIAGKWGKEEKTIPYFPFTAGDTFKMELLCEHQQIRVLLDGRQLCDFTHRIQPLSL
VKALRISGDVKLTKVA
Download sequence
Identical sequences H0ZMR3
ENSTGUP00000011887 ENSTGUP00000011887 59729.ENSTGUP00000011887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]