SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011928 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011928
Domain Number 1 Region: 476-671
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-59
Family Nucleotide and nucleoside kinases 0.0001
Further Details:      
 
Domain Number 2 Region: 321-462
Classification Level Classification E-value
Superfamily SH3-domain 7.48e-30
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 119-177
Classification Level Classification E-value
Superfamily L27 domain 2.41e-23
Family L27 domain 0.0000714
Further Details:      
 
Domain Number 4 Region: 253-337
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-19
Family PDZ domain 0.0000367
Further Details:      
 
Domain Number 5 Region: 184-236
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000306
Family L27 domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011928   Gene: ENSTGUG00000011569   Transcript: ENSTGUT00000012059
Sequence length 675
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:28384616:28410393:-1 gene:ENSTGUG00000011569 transcript:ENSTGUT00000012059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSHMNGHIAEDSDNETKNVDLVSPEEPQKHREMAVDCPGDLGSRMMPMRRSAQLERIR
QQQEDIRRRREEEGRKQELDLTASMRLKKLAQIPPKTGIDNPIFDTEEGIVLESPHYTVK
TLEVEELLNSLKHIQHVLVDPQSQEDISLILQLVQNSDFQNAFKIHNAVTVHMNKASPPY
PLSSNAQELAQEVQSVLKPSHHKDGQELNALLNAPHMQALLLAHDKVAEQEMQPEPMTDE
KIYENVGMYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDLLADMHGTLTFVLIPSQQSKPPPAKETVIHVKAHFDYDPSD
DPYVPCRELGLSFQKGDILHVISQEDPNWWQAYRDGDEDNQPLAGLIPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKR
PIVLIGPQNCGQNELRQRLMNNEVDRFAAAVPHTTRSRRETEAAGRDYHFISRQAFESDI
AAGKFIEYGEFEKNLYGTSIDSVRQVINSGKICLLNLHTQSLKTLRNSDLKPYIIFVAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLIN
KLDTEPQWVPSTWLR
Download sequence
Identical sequences H0ZMV4
ENSTGUP00000011928 ENSTGUP00000011928 59729.ENSTGUP00000011928 XP_012429657.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]