SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011974 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011974
Domain Number 1 Region: 89-187
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.68e-33
Family Thioltransferase 0.0000147
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.84e-26
Family Thioltransferase 0.0000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011974   Gene: ENSTGUG00000011617   Transcript: ENSTGUT00000012105
Sequence length 189
Comment pep:novel chromosome:taeGut3.2.4:6:35343130:35348202:1 gene:ENSTGUG00000011617 transcript:ENSTGUT00000012105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFMKGSPKEPRCGFSRQMVQLLQQHGVAFSTFDVFSDEEVRQGLKAFSNWPTYPQLYVR
GELVGGLDVVKELAASGELDTICPKGQKLEDRLKSLINKAPVMLFMKGNKQMAKCGFSKQ
IIEIMNNTGVDYETFDILEDEEVRQGLKSFSNWPTYPQLYVKGELVGGLDIVKELKESGE
LLPVLKGEN
Download sequence
Identical sequences H0ZN00
59729.ENSTGUP00000011974 ENSTGUP00000011974 ENSTGUP00000011974 XP_012430157.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]