SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011986 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011986
Domain Number 1 Region: 164-262
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.74e-32
Family Thioltransferase 0.0000147
Further Details:      
 
Domain Number 2 Region: 62-157
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.3e-29
Family Thioltransferase 0.0000665
Further Details:      
 
Domain Number 3 Region: 3-49
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000218
Family Thioltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011986   Gene: ENSTGUG00000011623   Transcript: ENSTGUT00000012117
Sequence length 264
Comment pep:known chromosome:taeGut3.2.4:6:35367481:35374839:1 gene:ENSTGUG00000011623 transcript:ENSTGUT00000012117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEAEAVPEVSEKYGISSVPTFLFFKNSQKVDRLDGAHAPELTQKVQRHAAGAAPAAPAQE
QLHARLSRLVNAAPCMLFMKGSPKEPRCGFSRQMVQLLQQHGVAFSTFDVFSDEEVRQGL
KAFSNWPTYPQLYVRGELVGGLDVVKELAASGELDTICPKGQKLEDRLKSLINKAPVMLF
MKGNKQMAKCGFSKQIIEIMNNTGVDYETFDILEDEEVRQGLKSFSNWPTYPQLYVKGEL
VGGLDIVKELKESGELLPVLKGEN
Download sequence
Identical sequences H0ZN12
ENSTGUP00000011986 59729.ENSTGUP00000011986 ENSTGUP00000011986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]