SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011992 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011992
Domain Number 1 Region: 961-1128
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-81
Family Thrombospondin C-terminal domain 0.0000000205
Further Details:      
 
Domain Number 2 Region: 30-239
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-40
Family Laminin G-like module 0.000000061
Further Details:      
 
Domain Number 3 Region: 838-959
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.09e-36
Family TSP type-3 repeat 0.000000209
Further Details:      
 
Domain Number 4 Region: 494-552
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 4.05e-16
Family TSP-1 type 1 repeat 0.0000358
Further Details:      
 
Domain Number 5 Region: 441-490
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 8.5e-16
Family TSP-1 type 1 repeat 0.0000501
Further Details:      
 
Domain Number 6 Region: 768-840
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000589
Family TSP type-3 repeat 0.00025
Further Details:      
 
Domain Number 7 Region: 322-380
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000136
Family VWC domain 0.0044
Further Details:      
 
Domain Number 8 Region: 697-781
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000196
Family TSP type-3 repeat 0.00011
Further Details:      
 
Domain Number 9 Region: 384-434
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000497
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 10 Region: 553-605
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000263
Family EGF-type module 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011992   Gene: ENSTGUG00000011624   Transcript: ENSTGUT00000012123
Sequence length 1128
Comment pep:novel chromosome:taeGut3.2.4:5:29079606:29134706:-1 gene:ENSTGUG00000011624 transcript:ENSTGUT00000012123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPILVQPAQQMALGGPNSSLSAESRNDDNSVFDLFELIGFMRKGAGRRAPGVYLVKGPES
SSPAYRIEDASRIPAVPDSKFQDLLDAIHAEKGFILLATLRQAKKSRGTLLSVEQNDGSG
HVFSLVSNGKAGSLDLSLSVDGKQQLVSVEDVLLATGHWKNITLFVQEDRAQLYVGCEKM
ENAELDIPIQNIFTRDLASSARLRIAKGGVNDNFQGLLQNVRFVFGTTLETILRNKGCSS
STSAVITLDNPINGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLRSMVTTLQ
DRVRKVTEENEIIAKVVQITPGACIHNGVLHKNKEEWTIDSCTECTCQNSATICRKVSCP
LMPCSNATVPDGECCPRCWPSDYADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCE
GSSVQTRTCHLQECDKRFKQDGGWSHWSPWSSCSVTCGTGIITRIRLCNSPVPQLNGKPC
EGEARENKACQKDPCPINGNWGPWSPWDACTVTCGGGLQKRSRLCNNPEPQYGGKTCVGE
ARGTQVCNKQDCPIDGCLSNPCFAGAACTSAPDGSWKCGACPAGYHGDGIHCQDIDECKE
VPDACFVFNGVHRCENTEPGYNCLPCPPRFTGTQPFGRSVEDAMSNKQVCKPRNPCTDGT
HDCNKNAKCNYLGHFSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCK
KDNCPNLPNSGQEDYDKDGIGDACDSDDDDDGIPDDRDNCPFIYNPQQYDYDRDDVGDRC
DNCPYNHNPDQTDTDNNGEGDACAIDIDGDGVLNERDNCQYVYNVDQRDTDLDGVGDQCD
NCPLEHNPDQEDTDSDRIGDQCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDAC
DHDDDNDGIPDDKDNCRLVANPDQADSDGDGRGDACKDDFDQDSVPDIDDICPENVEISE
TDFRKFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSGTFFI
NTERDDDYAGFVFGYQSSSRFYVVMWKQITQSYWDSTPTKAQGYSGLSIKVVNSTTGPGE
HLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIR
Download sequence
Identical sequences H0ZN18
59729.ENSTGUP00000011992 ENSTGUP00000011992 ENSTGUP00000011992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]