SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011997 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011997
Domain Number 1 Region: 443-711
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-75
Family Protein kinases, catalytic subunit 0.000000000139
Further Details:      
 
Domain Number 2 Region: 109-181
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.41e-24
Family Ras-binding domain, RBD 0.00039
Further Details:      
 
Domain Number 3 Region: 181-234
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000133
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011997   Gene: ENSTGUG00000011632   Transcript: ENSTGUT00000012128
Sequence length 760
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:59245937:59299157:1 gene:ENSTGUG00000011632 transcript:ENSTGUT00000012128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESMGNG
TDFSVSSSASTDTVASSSSSSLSVAPSSLSVYQNPADMSRNNPKSPQKPIVRVFLPNKQR
TVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDREKKPIGWDTDISWLTGEELHVEV
LENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQL
DLLFVSKFFEHHPIPPEEASLGETTPASGSYPSVPPSDSVGPPILPSPSPSKSIPIPQPL
RPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQSLRGEGAPLNQLMRCLRKYQ
SRTPSPLLHSVPSEIVFDFEPGPVFRGSAAGLSATPPASLPGSLTNVKALQKSPGPQRER
KSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLN
VTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIET
KFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSG
SQQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQII
FMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHR
SASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGGFPVH
Download sequence
Identical sequences H0ZN23
ENSTGUP00000011997 ENSTGUP00000011997 59729.ENSTGUP00000011997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]