SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012045 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012045
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.39e-27
Family Ubiquitin-related 0.00000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012045   Gene: ENSTGUG00000011687   Transcript: ENSTGUT00000012177
Sequence length 109
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:49956170:49965066:-1 gene:ENSTGUG00000011687 transcript:ENSTGUT00000012177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QINLRLILVSGKTKEFLFSPNDSAADIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLH
GNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Download sequence
Identical sequences A0A087QM86 A0A087V8L8 A0A091EJZ3 A0A091HMB4 A0A091IPX7 A0A091JE05 A0A091K1P4 A0A091KVW5 A0A091LJW2 A0A091MVJ8 A0A091MYK2 A0A091NHJ8 A0A091PXW7 A0A091R9A2 A0A091RKJ6 A0A091ST62 A0A091UQ98 A0A091WFJ6 A0A093EMH2 A0A093EXV6 A0A093F9F5 A0A093GQR2 A0A093I5X7 A0A093I603 A0A093IQH3 A0A093P682 A0A093R7Z7 A0A093SJD9 A0A094NJC0 A0A099ZDC6 A0A0A0ABP7 H0ZN70 R0LPH8
ENSTGUP00000012045 59729.ENSTGUP00000012045 XP_010216595.1.20684 ENSTGUP00000012045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]