SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012056 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012056
Domain Number 1 Region: 401-544
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-41
Family Third domain of FERM 0.00000957
Further Details:      
 
Domain Number 2 Region: 297-402
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-36
Family Second domain of FERM 0.00000375
Further Details:      
 
Domain Number 3 Region: 217-296
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-26
Family First domain of FERM 0.000064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012056   Gene: ENSTGUG00000011684   Transcript: ENSTGUT00000012188
Sequence length 1003
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:59791710:59851416:1 gene:ENSTGUG00000011684 transcript:ENSTGUT00000012188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSETEVKKDSEQLGPDKAKDKPEEASETPGDQKSKETFSGEAQDSSVPAPTNQSS
PSSQKKEKSSPESKGISRFLPPWLKKQKSYTLAEPKDEPKKKATGEEQVVEESESQALEG
VAQPRKSLEEATENRQNAKAGDKEKHSISSAEIQVSYKRNEQPSKEDGKETEVEEVAEKK
EEKQEEKEKRETKEVQTAEIKIDNVPQKSPKKIKTVQCKVMLLDGTEYSCDLEKRARGQV
LFDKVCEHLNLLEKDYFGLLFYENSEQKNWLDSSKEIKRQIRSLPWIFTFNVKFYPPDPS
QLTEDITRYFLCLQLRQDIVSGRLPCSFVTHALLGSYTLQAELGDHDPAEHSSDYISEFQ
FAPNQTQEMEEKVAELHKTHRGLTPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIMLG
VCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAK
RLWKVCVEHHTFFRLLSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASNLIDRPAPYFERT
SSKRVSRSLDGAPMGISDQGLVRDFSAAGGQAAGDKIIDLEAAGQAKLKEGGREEDESPL
KTPQLEFTQDGKISSLRVDGENIYVRHSNLMLEDLDKTQDDLLKHQASISELKRNFMEST
PEPRPNEWEKRRITPLSLQTQGSSHETLDIVEEKKQAEFGIEETLVVDETNKGKMQVATD
AGETCKVEHVSKKDSSSLPSDSSSSSSSESEDEEVGEYHPHHRAVEEVIREEQEEEEDMK
RKEHEENTQHVEAIPEGSKPVPVEHTQVTAEDLVQENTITVATEEKNLSEQIKQDVGEEK
EEEQLKLNGDVSHVDIDVAPQLICCSEPPVVKTEMVTISDATQRTEISTKEIPIVQTETK
TITYESSQLDGNAVGDTGVLVSAQTITSESISTTTTTHITKMVKGGVSETRIEKRIVITG
DADIDHDEALAQAIKEAKEQHPDMSVTRVVVHKETELAEEDED
Download sequence
Identical sequences H0ZN80
ENSTGUP00000012056 59729.ENSTGUP00000012056 ENSTGUP00000012056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]