SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012081 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012081
Domain Number 1 Region: 220-400
Classification Level Classification E-value
Superfamily MIR domain 9.42e-47
Family MIR domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1080-1171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.21e-18
Family SPRY domain 0.047
Further Details:      
 
Domain Number 3 Region: 660-808
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000019
Family SPRY domain 0.063
Further Details:      
 
Domain Number 4 Region: 3927-3987
Classification Level Classification E-value
Superfamily EF-hand 0.0000000864
Family Calmodulin-like 0.033
Further Details:      
 
Domain Number 5 Region: 2063-2127
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000248
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 6 Region: 2848-2919,2994-3236,3290-3315,3372-3392,3734-3758,3835-3974,4106-4134
Classification Level Classification E-value
Superfamily ARM repeat 0.00000633
Family MIF4G domain-like 0.086
Further Details:      
 
Domain Number 7 Region: 1335-1452
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000293
Family SPRY domain 0.018
Further Details:      
 
Domain Number 8 Region: 436-549
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000301
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012081
Domain Number - Region: 104-185
Classification Level Classification E-value
Superfamily MIR domain 0.000183
Family MIR domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012081   Gene: ENSTGUG00000011653   Transcript: ENSTGUT00000012215
Sequence length 4872
Comment pep:novel chromosome:taeGut3.2.4:5:29645499:29841591:-1 gene:ENSTGUG00000011653 transcript:ENSTGUT00000012215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGEGGEDEIQFLRTDDEVVLQCVASIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYVP
PDLCVCNFVLEQSLSVRALQEMLASTGDNASEGAAQGGGHRTLLYGHAILLRHSFSEMYL
TCLTSSRSQTDKLAFDVGLRENAAGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSVSNGNIQVDASFMQTLWNVHPICSGSNITEGYLLGGHVVRFFHGHDECLTIPSTD
QNDSQHKKVFYETGGAGIRARSLWRVEPLRISWSGSNIRWGQPFRLRHITTGKYLALNED
EGVVILDREKSDTASTAFCFRATKELKEKQESSMKRDIDGMGVPEIKYGDSICFVQHVAT
ALWLTYKAQDAKSARLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNTSSLFSH
FISGNNRALSPSALPVEEMAQTLQDLITYFQLPEEDLQHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNDYNSTAHFAGIAREEHGGTSWKEILNLLYKLLAALIRGNRNNCAQFS
CNLDWLISKLDRLESSSGILEVLHCILIESPEALNLISEEHIKSIISLLDKHGRNYKVLD
VLCSLCVCNGVAVRANQNLICDNLLPRRDLLLQTRLINDVTSIRPNIFLGVAEGSAQYKK
WYFELIIDQVDPFLTAEPTHLRVGWASTSGYAPYPGGGEGWGGNGVGDDLYSFGFDGLHL
WSGRVPRAVASVNQHLLASDDVVSCCLDLGVPSISFRINGQPVQGMFENFSTEGFFFPVV
SLSAGVKVRFLLGGRHGEFKFLPPAGYAPCYEALLPKEKMKLEPVKEYKRDFEGVRDLLG
TTQFLSQASFIPCPIDTSQIALPFHLEKIRDKLAENIHELWGMNKIELGWTYGKIRDDNK
RHHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIVHAHPAAEEDLKKVKLPKNYMM
SNGYKPAPLDLSEVKLLPSQEFLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRL
VPYALLDERTKKSNRDSLREAVRTFAGYGYSIEPPDQEIADQTVEKVSIDKIRFFRVEQS
YAVKSGKWYFEFEAVTGGDMRVGWARPGCRPDIELGADDQAFVFEGSKGQCWHQGSGFFG
RSWQSGDVVGCMINLDDKSIIFTLNGELLITSKGSELAFADFGIENGFVPICALGLSQIG
RMNLGMDASTFKYYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKTHPHIKIWRI
DGTIESPPRLKVTHKTFGTQNSNSDMIYCRLSMPVEFHSSFNFGMGVENASSDVFQKRKH
SQEIAPPSTTYFYSLRIFAGQDPSSVWVGWVTPDYHFYSENFDLNKNCTVTVTLGDERGR
VHESVKRSNCYMVWGGDAIANSQRSGRSNVDIEIGCFVDLATGMVSFTANGRELGTCYQV
EPNTKLFPATFLRPTSTNLIQFELGKLKNTMPLSAAIFKSEERNPIPQCPPRLDVQTITP
VLWSRMPNSFLRVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMMF
HYHTLKLYSSVSALGNTRVAYALCSHVDVSQLFFTIDNQYLPGLLRSGFYDLLISIHLEH
AKQAKLMMSNEFIIPVTDETRNIKLYPDETKKHGLPGVGLSTCLKPAFSFSTPCFIATSE
DHKTSIPEIPLEILKSKAISMLTEAVQCSGSHIRDPVGGQVAFQFVPVLKLIATLLVMGV
FDDDDVKQVLLLIDPTVFGDHKEEAEERTEKEEVTQVEEKAVEAGEKAIKQTKAPAKGLL
QTRLPESVKLQMCHLLNYFCDCELQHRVEAIVSFADRYVSKLQYNQKYRYNELMQALNMS
AALTAKKTKEFRSPPQEQINMLLNFQLGEDCPCPEEIREELYEFHDDLLIHCGIPLEEEE
EEEEDSSLTGKLRSLMYKIKGPPKAEKLEPREEEEKAPTTLKELISQTMVRWSQEDQIQD
PELVRIMYSLLRRQYDSIGELLQALRKAYTISAASVKDTINLLAALGQIRSLLSVRMGKE
EELLMINGLGDIMNNKVFYQHPNLMRVLGMHETVMDVMVNVLGGDKSQIAFPKMVASCCR
FLCYFCRISRQNQKAMFEHLSYLLENSSVGLAFPSMRGSTPLDVAAASVMDNNELALALE
EPDLDKYMVVTYLAGCGLQSCPVLLAKGYPDIGWNPIEGERYLSFLRFAVFANSESVEEN
ASVVVKLLIRRPECFGPDLRGEGGNGLLAAMQEAIRISENPSRDLPSQAYKREGEEEEEE
EETVHMGNAIMSFYSALIDLLGRCAPEMHLIQSGKGEAIRIRSILRSLVPTEDLVGIISI
PLKLSTVNKDGTVNEPDMSASFCPDHKAPMVLFLDRVYGIKDQSFLLHLLEVGFLPDLRA
SASLDTVSLSTTEAALALNRYICSAVFPLLKRCAPLFSGTEHHASLVDSMLHTIYRLSKG
RSLTKAQRDAIEECLLAICHHLRPSMLQQLLRRLVFDVPLLNEYCKMPLKLLTNHYEQCW
KYYCLPSGMGSYGIAAEEELHLTEKLFWGIFDSLSHKKYDPELFRMALPCLSAIAGLPPD
YLDTRIMSTLEKQTSVDPQRNFDPKPVSTSNLVLPEKLEYIVSKYAEHSHDKWAFEKTNS
GWKYGVSLDENMKTHPLIRPFKTLAEKEKEIYRWPARESLKTMLALGWSLERTKEGGEAI
IHQRENEKLRSISQSSQGNGYSPTPLDLSNVALSRELQGMVEVMAENYHNIWAKKKKMEL
ESKGGGSHPLLVPYDTLTAKEKSRDREKAQELFKFLQVNGIIISRGLNDMELDASSMEKR
FAFKFLKKILKYVDSAQEFIAHLEAIVTSGKTEKSPHDQEIKFFAKVLLPLVDQYFTNHC
LYFLSSPSKTLSSSGYASNKEKEMVASLFCKLAALVRHRISLFGSDSATMVNCLHILAQS
LDTRTVMKSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTV
ALLPILTSIFEHISQYHFGVDLLLGDVQVSCYRILCSLYSLGTGKNIYVERQRPALGECL
ASLAAAIPVAFLEPSLNHYNPLSVFNTKSARERAILGMPDTVEEMCPEIPQLDRLIKEIN
DLAESGARYTEMPHVIEVILPMLCNYLSYWWERGSESVPQSAGPCCTMITSEHLSIVLGN
ILKIINNNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLDKLKKKAMKIVMEEEQ
LKADNKNDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRANWLKKPDADSDELFRMV
AEVFILWCKSHNFKREEQNFVIQNEINNLAFLTGDTKSKMSKAMHVKSGGQDQERKKSKR
RGDLYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKTRYSHRDTDEEVKEHLRNNLH
LQEKSDDPAVKWQLNLYKDILKSDGPTDPEKNVERVQRISAALYHLEQVEQPLRSKKAVW
HKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLNGYQNFWIETEEYSFEEKLVQDLATS
PKKDEEEEEETEKNHPDPLHQIILYFSRSALTERSNLGHDPLYIAYSAMMAKSCQEEEEG
DEEKEKTFEEKEMEKQRTLYQQARLHDRGAAEMVLQMISASKGCTGPMVVETLKLGIAIL
NGGNTIVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTL
IVRERGEKVLQHDEFTRDLFRFLQLLCEGHNNDFQNYLRTQMGNTTTVNIIISTVDYLLR
LQESISDFYWYYSGKDVIDESGQRNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRL
WDAVVGFLHVFANMQMKLSQDSAQIELLKELLDLLKDMVVMLLSLLEGNVVNGTIGKQMV
DTLVESSSNVEMILKFFDMFLKLKDLTNSDAFKEYDPDGKGIISKKEFQKSMEAQKQYIQ
SEIEFLLSCTEADENDMFNYVDFVERFHEPAKDIGFNVVVLLTNLSEHMPNDPRLQSLLE
PAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRMQWEKPQVKESKRQFIFDVVNEG
GEQEKMELFVNFCEDTIFEMQLASQISETDSSERPEEEEEAEPAYVVDIGNDEEEEKSLE
PASAFAVACVAVKKNVSNFLKMVTVKNLRKQYRKVKKMTIKEMVKVFFSFFWILFVGTFQ
MFFSIVWGIFQILWSTVFGGGLVEGAKNIKVTKILGDMPDPTQFGIHDDVMEAEKAEGAE
HGIRAELGEFVKSEKGESDIIADIFGIPTKKEGSKHGHDAGLGDIAEILGTEIQTPSENT
AQKKTRLQISEIAKEAGTQRKAEAEKADMEDGEKQDKAKEVQSEQLEEGKMKKKKRRHGQ
KIEKPEAVMANFFKALEIYQTKMLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLD
EVEEDSNLWNSFAEEEEEEGMVFFVLEESTGYMAPALRALAVIHTVISFVCVIGYYCLKA
KVPLVVFKREKEVARKLEFDGLYITEQPTEDDIKGQWDRLVINTPSFPNNYWDKFVKRKV
INKYGDLYGAERIAELLGLDKSALDFSPVEESEPEEASLVSWLSSIDTKYHIWKLGVVFT
DNSFLYLAWYTTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLA
VVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPA
GDPYEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGN
DYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESFVWKMYQERCWDFFPAG
DCFRKQYEDQLG
Download sequence
Identical sequences H0ZNA5
ENSTGUP00000012081 ENSTGUP00000012081 59729.ENSTGUP00000012081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]