SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012086 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012086
Domain Number 1 Region: 3-78
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000811
Family Laminin G-like module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012086   Gene: ENSTGUG00000011729   Transcript: ENSTGUT00000012220
Sequence length 199
Comment pep:novel chromosome:taeGut3.2.4:3:60389104:60400336:-1 gene:ENSTGUG00000011729 transcript:ENSTGUT00000012220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSVQVDEDKVQTQRLPSDQPVSVKKLFVGGTSSPFQISPLRNIPPFEGCIWNLVINATP
MDFAQPVSFENADIGRCPTLEPEVRPTEDEDKPTHATVLVQPEPDTNGEKEGPRIPPASP
PPTPSLSSALGSLAAETKSASLSSAFDSITDSCAADTEPAILEGGKQFGLSRNSHIAVAF
DDTKVKNRLTIEFEVRTTA
Download sequence
Identical sequences H0ZNB0
59729.ENSTGUP00000012086 ENSTGUP00000012086 ENSTGUP00000012086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]