SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012110 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012110
Domain Number 1 Region: 777-1086
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.35e-108
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000133
Further Details:      
 
Domain Number 2 Region: 1044-1344
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-83
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000842
Further Details:      
 
Domain Number 3 Region: 296-493
Classification Level Classification E-value
Superfamily Fibronectin type III 6.07e-25
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 3-95
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-20
Family MAM domain 0.0000359
Further Details:      
 
Domain Number 5 Region: 193-325
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000382
Family Fibronectin type III 0.0066
Further Details:      
 
Domain Number 6 Region: 99-201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000951
Family I set domains 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012110
Domain Number - Region: 510-622
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0501
Family Fibronectin type III 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012110   Gene: ENSTGUG00000011742   Transcript: ENSTGUT00000012244
Sequence length 1346
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:60953017:61207873:1 gene:ENSTGUG00000011742 transcript:ENSTGUT00000012244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKENDTHCIDFSYLLYSKNGGNPGTLNILVRVNKGPLANPIWNVTGSTGKDWLRAELAVS
TFWPNEYQVIFEAEVSDGRNGYIAIDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATFQCI
ATGRDAVNNKLWLQRRNGEDIPVAQTKNINHRRFAATFKLQEVTKTDQDLYRCVTQSERG
SGVSNFAQLIVREPPRPIAPPQLLGVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGTW
TETHAVNAPTYKLWHLDPDTEYEIRVLLTRPGEGGTGQPGPPLITRTKCAEPMRTPKTLK
IAEIQARHIAVDWESLGYNITRCHTFNVTICYHYFCGHNESKADCLDMDPKAPQHVVDRL
PPYTNVSLKMILTNPEGRKESEETIIQTDEDVPGPIPAKSVKGTPFEDKIFLNWKEPVDP
NGIITQYEVSYSSIQSFDPAVPVAGPPQTVSKLWNSTHHIFSHLHPGTTYQFFIRASTVK
GFGPATTINVTTNISAPTLPDYEGVDASLNETATTITVLLRPAQAKGAPISAYQIVVEEL
HPHRTKRETGAMECYQIPVTYQTALSGGSPYYFAAQLPPGNLPEPAPFTVGDNRTYQGFW
NPPLAPRKGYNIYFQAMSSVEKETKTQCVRIATKAAATEEPEVIPDPAKQTDRVVKIAGI
SAGILVFILLLLVVILIVKKRLGSKLAKKRKDAMGTTRQEMTHMVNAMDRSYADQSTLHA
EDPLSITFMDSHNFSPRYENHSATAESSRLLDVPRYLCEGTESPYQTGQLHPAIRVADLL
QHINLMKTSDSYGFKEEYESFFEGQSASWDVAKKDQNRTKNRYGNIIAYDHSRVILQPVE
DDPSSDYINANYIDGYQRPSHYIATQGPVHETVYDFWRMIWQEQSACVVMVTNLVEVGRV
KCYKYWPDDTEVYGDFKVTCVEMEPLAEYVVRTFTLGRRGYNEIREVKQFHFTGWPDHGV
PYNATGLLSFIRRVKLSNPPSAGPIVVHCSAGAGRTGCYIVIDIMLDMAEREGVVDIYNC
VKALRSRRINMVQTEEQYIFIHDAILEACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHL
KDEFQTLNSVTPRLQAEDCSIACLPRNHDKNRFMDMLPPDRCLPFLITIDGESSNYINAA
LMDSYRQPAAFIVTQHPLPNTVKDFWRLVYDYGCTSLVMLNEVDLAQGCPQYWPEEGILR
YGPIQVECMSCSMDCDVINRIFRICNLTRPQEGYLMVQQFQYLGWASHRDVPASKRSFLK
LILQVEKWQEECEEGEGRTIIHCLNGGGRSGMFCAIGIVVEMVKRQNVVDVFHAVKTLRN
SKPNMVETPEQYRFCYDVALEYLESS
Download sequence
Identical sequences H0ZND4
59729.ENSTGUP00000012110 ENSTGUP00000012110 ENSTGUP00000012110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]