SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012212 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012212
Domain Number 1 Region: 2169-2468
Classification Level Classification E-value
Superfamily BEACH domain 3.79e-113
Family BEACH domain 0.0000000000567
Further Details:      
 
Domain Number 2 Region: 113-299
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.44e-32
Family Clostridium neurotoxins, the second last domain 0.027
Further Details:      
 
Domain Number 3 Region: 2057-2164
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-30
Family PreBEACH PH-like domain 0.00000217
Further Details:      
 
Domain Number 4 Region: 2587-2696,2732-2845
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.85e-27
Family WD40-repeat 0.0074
Further Details:      
 
Domain Number 5 Region: 391-498,577-873
Classification Level Classification E-value
Superfamily ARM repeat 3.31e-16
Family Plakophilin 1 helical region 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012212   Gene: ENSTGUG00000011819   Transcript: ENSTGUT00000012346
Sequence length 2855
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:51982562:52371027:1 gene:ENSTGUG00000011819 transcript:ENSTGUT00000012346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVGGEFDLEMNFIIQDAESITCMSELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVG
LIEQVLLKMSTVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGENGIWPRHAVKLLS
VLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKP
YLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWR
NSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETADANRVFCGQLGAVYVFTEALN
PAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAKATDAQLCL
ESSPKENPSIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLHDSQ
VETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFA
KYLDGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATIYNTIRRVG
TVLQLMHTLKYYYWVVNPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGV
KEDELQSILNYLLTMHEDENIHDVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKS
ESIWVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTYNTLYEILT
EQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSN
SRENRRCLLQCSVWQDWMFSLGYINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVW
VDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQTTGAKGGM
EIREIEDLSQSQSPESETDYPVNTDTRDLLMATKVSDDVLGTAERPGGGGVHVEVHDLLV
DIKAEKVEATEVKLDDMDLSPETLGTGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGI
IKKNEEKDNGPLITLADEKDEPSTNNTSFLFDKIPSQEEKLLPELSSNHIAIPNVQETQM
HLGVNDDLGLLAHMTGSVDITCASSIIEDKEFKIHTTSDGMNSISERELSSSSKGLEYAE
MTATTLETESSGSKTVPNVDAGSIISDTERSDDGKEAGKEIRKIQTTTTTQAIQGRSVTQ
QDRDLRVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALETDVH
VWRSHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTVSTTE
LENIEVTQGMSAETAVTFLSRLMAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVC
CVAVRNCLECRQRQRERVNKTSLIGSKPQDALQGVTASAATKTPLENVPGNLSPIKDPDR
LLQDVDINRLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETARSGSQA
GRNIRQEINSPTSTVVVIPSIPHPSLNHGFLAKLIPEQSFAHSFYKDTPTVFPENIKDKE
TPTPVEDIQLESSIPHTDSGIGDEQMPNILNGTDLETSTGPDAMSELLSTLSSEVKKSQE
SLTESPSEILKPASSISSISQSKGINVKEILKSLVAAPVEIAECGPDPIPYPDPALKREA
QAILPMQFHSFDRSVVVPVKKPPPGSLAVTTVGAATAGSGLPPGSTPNIFAATGATPKSM
INTTGAGAVDSGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLERALEK
VAPLLREIFVDFAPFLSRTLLGSHGQELLIEGLVCMKSSTSVVELVMLLCSQEWQNSIQK
NAGLAFIELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESQCAQYAADR
REEEKMCDHLISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFWRLDYWEDD
LRRRRRFVRNAFGSTHADALLKAAVEYGTEEDVVKSKKTFRSQAVVNQNAETELMLEGDD
DAVSLLQEKEIDNLAGPVVLSTPAQLIAPVVVAKGTLSITPTEIYFEVDEDDSAFKKIDP
KVLAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQATVKKVVYSL
PRVGVGTSYGLPQARRISLATPRQLYKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDL
NQYPVFPWVLTNYESEELDLTLPGNFRDLSKPIGALNPKRAVFYAERYETWEDDQTPPYH
YNTHYSTSTSTLAWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRNSQRDTSDVKEL
IPEFYYLPEMFVNSNGLHLGSGRRIVVNDVDLLHGQSLRLCRLEFHLQALESEFVSCQLH
QWIDLIFGYKQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQL
LIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLTIPAV
VTVTCSRLFAVNRWHNTVGVGLRGAPGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVD
QSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYI
GGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDYPAPRAVLTGHDHEVVCVSVCAELX
XXXXXXXXTEGPCLVHTITGDLLRALEGTENCLYPRLISVSSEGHCIIYYERGRFSNFSI
NGKLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMD
LSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY
Download sequence
Identical sequences H0ZNN5
ENSTGUP00000012212 ENSTGUP00000012212 59729.ENSTGUP00000012212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]