SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012225 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012225
Domain Number 1 Region: 1093-1167,1194-1243,1309-1334,1372-1570
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.03e-86
Family Hect, E3 ligase catalytic domain 0.000049
Further Details:      
 
Domain Number 2 Region: 229-297
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 1.31e-22
Family Mib/herc2 domain 0.00000897
Further Details:      
 
Domain Number 3 Region: 49-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000922
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012225   Gene: ENSTGUG00000011864   Transcript: ENSTGUT00000012359
Sequence length 1578
Comment pep:novel chromosome:taeGut3.2.4:5:34189233:34216069:-1 gene:ENSTGUG00000011864 transcript:ENSTGUT00000012359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKQWYDFDRASFVFVRKLREGQTFVFRHQHDFDENGIIYWIGTNAKTAYEWVNPAAYGLV
VVTSSEGRNLPYGRLEDILSRDSSALNCHTNDDKNAWFAIDLGLWVIPSAYTLRHARGYG
RSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTATWPLDPPKDEKQGWRHVRIKQMG
KNASGQTHYLSLSGFELYGTVNGVCEDQLGKAAKEAEANLRRQRRLVRSQVLKYMVPGAR
VIRGIDWKWRDQDGSPQGEGTVTGELHNGWIDVTWDAGGSNSYRMGAEGKFDLKLAPGYD
PDSAASPKPVSSTVSGTTQSWSSLVKNNCPDKTTAAAGSSSRKGSSSSVCSVASSSDISL
GSTKMERRSESVLEQNIVSGTDIHEPIVVLSSADSVPQADIGSSSSASTSTLTADMGNEN
AERKLGPDNSIRTPGESSAISMGIVSVSSPDVSSVSELTNKEAASQRPLSSSASNRLSVS
SLLAAGAPMSSSASVPNLSSRETSSLESFVRRVANIARTNATNNMNLSRSSSDNNTNTLG
RNVVSTATSPLMGAQSFPNLTTTGTTSTVTMSTSSVTSSSNVATATTVLSVGQSLSNTLT
TSLTSTSSESDTGQEAEYSLYDFLDSCRASTLLAELDDDEDLPEPDEEDDENEDDNQEDQ
EYEEVMVRYNSFSFLHMVKTTRKCVTAVFMNSQFFNQIILFSGIKTKQLGFLGEEEEYET
KGGRRRTWDDDYVLKRQFSALVPAFDPRPGRTNVQQTTDLEIPPPGTPHSELLEEVECMP
SPRLALTLKVSGLGTTREVELPLTNFRSTIFYYVQKLLQLSCNGSVKSDKLRRIWEPTYT
IMYREMKDSDKEKESGKMGCWSVEHVEQYLGTDELPKNDLITYLQKNADSAFLRHWKLTG
TNKSIRKNRNCSQLIAAYKDFCEHGSKSGLSQGAISTLQNSDILSLAKEQPQAKAGSGQN
SCGVEDVLQLLRILYIVASDPYTTRISQEEGDEHPQFNFPPDEFTSKKITTKILQQIEEP
LALASGALPDWCEQLTSKCPFLIPFETRQLYFTCTAFGASRAIVWLQNRREATVERTRTT
STVRRDDPGEFRVGRLKHERVKVPRGESLMEWAENVMQIHADRKSVLEVEFLGEEGTGLG
PTLEFYALVAAEFQRTDLGAWLCDDDFPDDESRQVDIGGGLKPPGYYVQRSCGLFTAPFP
QDSDELERITKLFHFLGIFLAKCIQDNRLVDLPISKPFFKLMCMGDIKSNMSKLIYESRG
DRDLHCTESQSEASTEEGHDSLSVGSLEEDSKSEFILDPPKPKPPAWFNGILTWEDFELV
NPHRARFLKEIKDLAIKRRQILSNKNLSEDEKNTKLQELMLKNPSGSGPPLSIEDLGLNF
QFCPSSKVYGFTAVDLKPGGEDETVTMDNAEEYVDLMFDFCMHTGIQKQMEAFRDGFNRV
FPMEKLSSFSHEEVQMILCGNQSPSWAAEDIINYTEPKLGYTRDSPGFLRFVRVLCGMSS
DERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLKLPEYSSEE
IMRERLLAATMEKGFHLN
Download sequence
Identical sequences H0ZNP8
59729.ENSTGUP00000012225 ENSTGUP00000012225 ENSTGUP00000012225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]