SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012227 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012227
Domain Number 1 Region: 23-154
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000051
Family Growth factor receptor domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012227   Gene: ENSTGUG00000011862   Transcript: ENSTGUT00000012361
Sequence length 960
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:132243591:132273612:1 gene:ENSTGUG00000011862 transcript:ENSTGUT00000012361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARGFSVPLQRPADCGPDRYFDSSRLACAPCGAHQRQSAGGSSCECEPGYRMVSSSGGFSV
TCEKCPENMSGVTRDGWNCITCPRGLTSEGNCKCPNNEILVERSVDGVLLSEARCIHCNG
SEESFSAPDASGSRCVRCEKTFIQVSKSCDCNTPNIPTGGLCFLAREGLPPKGVAAVRFA
QLGITLASAWFLKNLQSSAFACWLYSNLTACQALGNMCVMNMNSLSSSSTDACGLFQYIF
VSTARVGIIHSIPYWRHNLPWLYYGDQPGLASQVLEKNHFPTTFTFKGTDKDVKLKFIAA
SFDASGNFLNWQSLEGGLLQLCPDTQTKLNAAYVFGTTYQQNCKISVSKILLDFANPVFY
DLFLEYNGGNGQKHLWAVPVLNLNLQYNEKFVNQGSNMNNWLLIRRFFLVDALSGKENDL
GKPPRVIRIASKITISIRLVSHTQRGTIYPPLITVAYTDVLIQNPETQSVMVSFAVSYEM
NQREAQIQTDIALGVLGGLAVLWSLLKTAGWKRRTGSSIIDLQTVFKFLLFYAGDLANVF
FIITVGTGIYWLVFFKAQQFVSVLLPLPSQEEDFVTYIACAFSLKALQFLHLLVSQLAID
IFFIDWERPKGKVFKAVEGEGVTKSAAAPVSIWRTYFIANEWNEIQTVRKINPLFQVLAV
LFFLEVVGFSNLALMDASSSLTRSSESYVAPWSRILRFGVSAALWVAIAILQVIFFAVIY
ERFVEDKISQFVDLCCVSNISVFLLSHNCFGHYIHGRSVHGHADTNMEEMNMNLKREAEN
LCSQRGLLPNTDGQTFQISISRKMRLNYDWIHETLTRKHGPARLLNSSANTSEQSTRAYN
AMNKFLCSFIDHVHKEMDYIVKDKLLLERILGMEFMEPIEKSIFYNDEGHSFTDVLYYGN
ETTLLIFDILFFSVVDLASQSFVLAAILTYLQQELFRFIRNTLGQKNLASKTLVDQRFLI
Download sequence
Identical sequences H0ZNQ0
ENSTGUP00000012227 59729.ENSTGUP00000012227 ENSTGUP00000012227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]