SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012267 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012267
Domain Number 1 Region: 218-379
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.48e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000457
Further Details:      
 
Domain Number 2 Region: 3-113
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-27
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 3 Region: 117-215
Classification Level Classification E-value
Superfamily LCCL domain 7.06e-25
Family LCCL domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012267   Gene: ENSTGUG00000011905   Transcript: ENSTGUT00000012402
Sequence length 515
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:65594108:65623388:-1 gene:ENSTGUG00000011905 transcript:ENSTGUT00000012402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGCGHTVMYQDSGTLASKNYPGTYPNYTLCEKKIQVPPGKRLILKIGDLDIESQKCESS
YLTIQSSSTLHGPYCGNVMPVPKEIILDSNEATIHFESGSHVSGRGFLLSYASSDHPDLI
TCLERANHYTKAEFSRYCPAGCRDIAGDISGNIGEGYRDTSLLCKSAIHAGVVADELGGQ
ISVTQHKGISRYQGVVANGVPSLDGSLSDKRFTFTSNGCNKSLSLEEGFLSKSQVTASSY
WEETNEFGQLLLWSPDKAWLQVPGWSWASNHSSNREWLEIDLGEKKRITVKGIKTTGSGS
MDFNFYVKTFTMNYKNNNSKWRTYKGILSNEEKVFQGNSNSGDIVRNNFIPPIVARYVRI
IPQTWNQRIALKLELMGCRIMPANSSFTHSMWQKPSQSTETSLGKEDKTVTEPIPSEETS
LGLKLTAIIVPIFIMLFLFLFSGICICTALRKREAKGLSYGLSSTQKSGCWKQIKQPFTR
HQSTEFTISYNNEKETPQKLDLVTSDMADYQQPLM
Download sequence
Identical sequences H0ZNU0
59729.ENSTGUP00000012267 ENSTGUP00000012267 ENSTGUP00000012267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]