SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012285 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012285
Domain Number 1 Region: 282-412
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-34
Family Cadherin 0.00092
Further Details:      
 
Domain Number 2 Region: 174-301
Classification Level Classification E-value
Superfamily Cadherin-like 2e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 65-178
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-24
Family Cadherin 0.00016
Further Details:      
 
Domain Number 4 Region: 393-500
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-16
Family Cadherin 0.0031
Further Details:      
 
Domain Number 5 Region: 2-72
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000286
Family Cadherin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012285   Gene: ENSTGUG00000011921   Transcript: ENSTGUT00000012420
Sequence length 500
Comment pep:novel chromosome:taeGut3.2.4:2:132790813:132792327:1 gene:ENSTGUG00000011921 transcript:ENSTGUT00000012420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AINYSLHGQGASSEFSINENTGEISAHKRLDREKRSTWRFLVLATDEGGEGLTGFADVII
EVRDVNDNAPLFLCVSDGCFTGHIPEDSPADTPIMEMTAVDLDDPKAGINAVLTYSIIQN
VKNEINLNLFSIDSVSGTISTVLGSLDREKEDKYLVVVEARDGGGLTGTGTATILVTDVN
DHAPVFLQRIYTAFVSENASINTEVVMVSAVDRDEGENAMVAFSIIDGDNDRKFSIETDE
VNNCGFIRLRKRVDFEKPHERVFNLTVKAEDMDFFSITHCVIYVEDSNDHAPVFYPQFYE
VAALGEDVPVGTRVIQVSAVDLDSGLNGRFSFHLLNKSDPGGQFSLASDGWLMVAGLLDY
ETVAQYQLVVIATDMGQPPLTGSATVLVTLQDVNDNGPEFEAHYNPVVWENTASPQATST
LLYAKDRDTAANGAPFSFRLLSDFDSLTSFSLQDFHNGSAVLTALRTFDREVHKVFYLPI
LITDSGIPPMSSTNTLTVNI
Download sequence
Identical sequences H0ZNV6
ENSTGUP00000012285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]