SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012313 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012313
Domain Number 1 Region: 137-253
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 6.52e-51
Family Neurotrophin 0.00000131
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012313
Domain Number - Region: 104-151
Classification Level Classification E-value
Superfamily L21p-like 0.0288
Family Ribosomal protein L21p 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012313   Gene: ENSTGUG00000011951   Transcript: ENSTGUT00000012448
Sequence length 257
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:63193333:63194106:-1 gene:ENSTGUG00000011951 transcript:ENSTGUT00000012448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILFYVIFLAYLRGIQSSNMDQRSLPEDSINSLIIKLIQADILKNKLSKQMVDIKENYQ
NTVQKTDTQQDMDGEENVKSDFQPVISVDTDLLRQQRRYNSPRVLLSDNTPLEPPPLYLM
EDYIGNSVVVNRTSRRKRYAEHRGHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIK
TGNSPVKQYFYETRCKEAKPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWI
RIDTSCVCALSRKIGRT
Download sequence
Identical sequences H0ZNY4
59729.ENSTGUP00000012313 ENSTGUP00000012313 ENSTGUP00000012313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]