SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012317 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000012317
Domain Number - Region: 31-101
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00332
Family Allantoicase repeat 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012317   Gene: ENSTGUG00000011955   Transcript: ENSTGUT00000012452
Sequence length 104
Comment pep:novel chromosome:taeGut3.2.4:2:132998556:133001609:-1 gene:ENSTGUG00000011955 transcript:ENSTGUT00000012452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCPVYLGGSLSPSGIGTNISKRTCDQLRCTACDFRVSLFNDYIWDQSCDYLFFRNNMPEL
SKLRAKMIKKKGARAYACQCSWRSIDELTDLQTEQQLRWVCGKH
Download sequence
Identical sequences A0A091EJL9 H0ZNY8
ENSTGUP00000012317 ENSTGUP00000012317 59729.ENSTGUP00000012317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]