SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012325 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012325
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.49e-40
Family BM-002-like 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012325   Gene: ENSTGUG00000011962   Transcript: ENSTGUT00000012461
Sequence length 83
Comment pep:novel chromosome:taeGut3.2.4:1:53692631:53700496:1 gene:ENSTGUG00000011962 transcript:ENSTGUT00000012461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKVTFKVTLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQ
TAGNVFLKHGSDLRLIPRDRVGS
Download sequence
Identical sequences H0ZNZ6
ENSTGUP00000012325 59729.ENSTGUP00000012325 ENSTGUP00000012325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]