SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012362 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012362
Domain Number 1 Region: 566-791
Classification Level Classification E-value
Superfamily vWA-like 4.26e-62
Family Integrin A (or I) domain 0.00028
Further Details:      
 
Domain Number 2 Region: 6-192
Classification Level Classification E-value
Superfamily vWA-like 1.95e-57
Family Integrin A (or I) domain 0.00033
Further Details:      
 
Domain Number 3 Region: 196-316
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.69e-18
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 278-398
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000502
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 360-480
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 6 Region: 482-607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000267
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 863-905
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000549
Family Chicken cartilage matrix protein 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012362   Gene: ENSTGUG00000011992   Transcript: ENSTGUT00000012499
Sequence length 907
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:134004617:134048324:1 gene:ENSTGUG00000011992 transcript:ENSTGUT00000012499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLENSCNNKHLDLVFIIDSSRSVSHYDFEKVKEFILTILQFLDISPDATHVGLIQYGSTV
KQEFSLKTFRRKQDIERAVKRMMHLGTGTMTGLALQYAVNIAFSETEGARPLRQNVPRII
MIVTDGRPQDPVAEIAAKARNSGILIFAIGVGRVDMNTLKSIGSEPHEEHVFLVANFSQI
ETLTSAFQTKLCVPHMCSIVEHHCDHFCINTPGSYLCRCKQGYILNADQKTCSTQDLCAV
EKHACEQICVNTLGSYVCQCYDGYELDANGKSCVVVDYCALDNHGCQHECVNTKDSYYCR
CHPGFILNPDKRTCGKPDYCSLQDHGCEQECVNTDDSYFCQCQEGFRLNPDKKTCKKVNF
CALGQHDCEHECVNMEELFVCKCHPRYTQEHRGDTCSRVDHCAESNHGCEQLCLNTGDSY
VCQCSEGFVINEDLKTCSRVDHCALSDHGCEHLCVNGDRSYTCQCFEGYRLRNDGKTCKR
KDICKSVNHGCEHVCASAGDSFVCKCQEGFLLREDGKTCRNKDICKSVNHGCEHVCVNSG
DSYTCKCHDGFLLREDGKTCRNKDLCKSIDHGCEHVCINNNNSYSCQCHEGFVLRQDGRT
CRRCTEGPIDLVFVIDGSKSLGEDNFEIVKQFVSGILDTLEISPKAARVGLLQYSTEVRT
EFTLRQFSSAKDMKKAVSQMKYMGRGSMTGLALRQMSERSFTETEGARPFSANVPRISIV
FTDGRAQDEVSEWATRAKQRGIIIYAIGIGKAIEEELLEIASEPSYKHLFYAEDFTALED
ISEELRAQICEALKESPHQQDASSGRLHKTGPQPSGPESTTIAITDVIDCPHLAVHHKYL
FEDSHIHSTTVLTESASGPKASKDNDQCKCENLVTFQNYATSEVRKLTQRYILSEQRMED
LENRLKY
Download sequence
Identical sequences H0ZP33
ENSTGUP00000012362 59729.ENSTGUP00000012362 ENSTGUP00000012362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]