SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012383 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012383
Domain Number 1 Region: 798-906
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-23
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 2 Region: 282-408
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 3-130
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.49e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 243-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000393
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 606-719
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000269
Family Growth factor receptor domain 0.0071
Further Details:      
 
Domain Number 6 Region: 131-280
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000502
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 681-795
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000426
Family Growth factor receptor domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012383   Gene: ENSTGUG00000012016   Transcript: ENSTGUT00000012521
Sequence length 984
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:64375765:64561973:1 gene:ENSTGUG00000012016 transcript:ENSTGUT00000012521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECAEATDDCHIDAICQNTPKSYKCICKPGYKGEGKQCEDIDECENDFYNGGCVHECI
NIPGNYRCTCYDGFMLAHDGHNCLDVDECLDNNGGCQQICVNTMGSYECQCKEGFFLSDN
QHTCIHRSIEGMNCMNKDHGCAHICRETPKGGVACECRPGFELAKNQKDCKLTCNYGNGG
CQHTCDDTDTGPVCGCHQKYALHSDGRTCIEKDEAAIESSEYNATSVADVDKRVKRRLLM
ETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTCKDIDECLVNNGGCDHFCRNTVG
SFECSCQKGYKLLTDERTCQDIDECSFERTCDHTCINYPGSFECLCHKGYTLYGLTHCGD
IDECSISNGSCDFGCLNTMGSYECVCPPGKKLHWNKKDCVEVVKCLPNAKPAPKAQLVCS
KTGGIESCFLSCPSNTLFVPDSENSYTLSCGVPVQHGKAQPRRNSTMPSCSDSLAPPVKQ
KARFKIKDAKCHLRPRSKEKTKDSGKQAVSDNCQVTFVNLKCDSSKKKRRGRKSPSKEVS
HITAEFEVEMKSEEVSDTCNIDCVRKRMEQKLQTAIKTLRKSINKQQFYIQFSGTEYEVA
QKPAKATEGHEACSTGQVLQDGKCVTCSTGTFYSGEHNQCVPCSPGTYQDTEGQLTCEPC
PSNDGQGVAGARNVSECGGNWQCSPGHYSSDGFKPCTVCPLGMYQPEPGRTLCFPCGGGL
VTKYEGAVSFQDCETKVHCSPGHYYNSTTHRCIRCPVGTYQPEFGQNYCITCPGNTSTDF
DGSTNVTHCKNQHCGGELGDYTGYIESPNYPGDYPANVECIWNINPPPKRRILIVVPEIF
LPIEDECGDVLVMRKSASPTSITTYETCQTYERPIAFTSRSRKLWIQFKSNEGNSGKGFQ
VPYVTYDEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQES
KEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences H0ZP53
ENSTGUP00000012383 59729.ENSTGUP00000012383 ENSTGUP00000012383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]