SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012450 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000012450
Domain Number - Region: 284-349
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00167
Family Ubiquitin-related 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012450   Gene: ENSTGUG00000012086   Transcript: ENSTGUT00000012588
Sequence length 372
Comment pep:novel chromosome:taeGut3.2.4:2:135546308:135584517:1 gene:ENSTGUG00000012086 transcript:ENSTGUT00000012588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STFQYTLEATKSLRQKQGEGPMTYLNKGQFYAITLSETGDNKCFRHPISKVRSVVMVVFS
EDKNRDEQLKYWKYWHSRQHTAKQRVLDIADYKESFNTIGNIEEIAFNAVSFTWDVNEEA
KIFITVNCLSTDFSSQKGVKGLPLMIQIDTYSYNNRSNKPIHRAYCQIKVFCDKGAERKI
RDEERKQNRKKGKGQASQASCNNGDALPLQKKSDITFFKTMADLDSQPVLFIPDVHFGNL
QRTGQVGNNEVSSSSVLVKRMFRPVEEEFGPSPLKQIKEEGLKRVLLYVRKETDEVFDAL
MLKSPTVKGLMEAISEKYGLPVEKIAKLYKKSKKGILVNMDDNIIEHYSNEDTFILNMES
MVEGFKITLTEI
Download sequence
Identical sequences H0ZPC0
59729.ENSTGUP00000012450 ENSTGUP00000012450 ENSTGUP00000012450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]