SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012486 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012486
Domain Number 1 Region: 25-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-17
Family SPRY domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012486   Gene: ENSTGUG00000012117   Transcript: ENSTGUT00000012625
Sequence length 196
Comment pep:known chromosome:taeGut3.2.4:1:55948726:55958266:1 gene:ENSTGUG00000012117 transcript:ENSTGUT00000012625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVFCCFSWCRDGGAGHIPLKEMPAVHLDTQRMGTDVVIVKNGRRICGTGGCLANAPL
HQNKSYFEFKIQSTGIWGIGVATQKANLNQIPLGRDVHSLVVRNDGALYYNNEEKNRLPA
NNLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYH
TPPPGFEKILFEQQIF
Download sequence
Identical sequences A0A218UT89 B5FZQ5
59729.ENSTGUP00000012486 ENSTGUP00000012486 XP_021382259.1.53032 ENSTGUP00000012486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]