SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012510 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012510
Domain Number 1 Region: 1111-1175
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.68e-21
Family TB module/8-cys domain 0.0000473
Further Details:      
 
Domain Number 2 Region: 370-438
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-20
Family TB module/8-cys domain 0.00041
Further Details:      
 
Domain Number 3 Region: 1283-1342
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-16
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 4 Region: 615-753
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000157
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 5 Region: 254-320
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000249
Family TB module/8-cys domain 0.0039
Further Details:      
 
Domain Number 6 Region: 926-1046
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000282
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 318-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000469
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 551-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000472
Family EGF-type module 0.015
Further Details:      
 
Domain Number 9 Region: 746-794
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000211
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 800-924
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000675
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 1182-1230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000434
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 1040-1078
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000154
Family EGF-type module 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012510
Domain Number - Region: 111-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000782
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012510   Gene: ENSTGUG00000012131   Transcript: ENSTGUT00000012649
Sequence length 1392
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:38044496:38078796:-1 gene:ENSTGUG00000012131 transcript:ENSTGUT00000012649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPQHTGSSRTVRRYPASNSQLTSNALPNGNGHEQSRSGPHAVSQEHTLSAKGANLTEKIR
KIKIVFTPTICKQKCQSGRCYNSCEKGDTTTLYSQGGHDHDPKSGFRIYFCQIPCLNGGR
CVGRDECWCPSNSTGKFCHLPAPSLEKKQGGSGPKPPAGSSMRHSTYTLPLSNQLASLNP
SLVNVHVNHPPEAIVQIHQVARVRADAEASEENSVEAVLVPQLTSVPWYTYSHGNGNSIA
TESRQQQQRAPGLLGRCFREALHGQCTNPLPGLTKLEDCCGSVGLFWGVDQCLACPPRPA
HPVIENGQVECPQGYKRLNRSHCQDINECLMQGLCKDAECMNTRGSFRCTCKPGTMLDPS
RSHCISDKAVSMEQGLCYRSAAGGVCTFPLSHRITQQICCCSRVGKGWGENCEECPMPGS
EAFKEICPAGHGYTYSSSDIRLSMRKAETEELPFSLEEQGEKSNWTLDWTARRQQLQDSL
RGSILEAFLYPGTSARQGSVGPSVGQAPGWAGSATTPQPLPIGVLAWCQQVGVCPPVMRI
SCLSLPGVSGCASSPLSCGAGACVLTPEGYSCLCHPGYTLDPSRLHCIDEDECLKDPCAG
KGRCINSVGSYFCLCYSGYTLAVSVGKQSCEDRDECEQPSICRGQQCINTPGSYHCQCKE
GFAMGPRGQCEDVNECVDPSSCPGGRCVNTLGSYKCVSCAAGYRPRDGRCIDVDECLVEG
TCAHGQCVNLDGSFRCSCYRGYDVAPDGKSCQDIDECSSQAPCPSGLCLNTEGSYSCMSC
DTGYAVSRDGSTCEGLETDCEHPELCSRNCCRPLNSFSTRRTFAGASLCAVPFLLADLDE
CEDPAVQCLGGECRNTLGSYECHCQTGFELINGTICKDMNECLNSEICSPNGECLNSQGS
YFCICAPGFSSVAGGVSCQDVDECAVTLCSRGQCLNTEGSYRCLCENGFKHSQETDDCVD
MDECKEYGDAICGTWRCQNSLGSYRCIMGCQPGFHWTPLGDCIDIDECANETLCGSHGFC
ENSDGSFRCLCDRGYESSPSGHHCIDVNECELMVAVCGTALCENVEGSFLCLCPSDHEEY
DTEAGQCKPRAAVGESMGSDTHAAHLSDSAERKQCYYHISDVRLCDSVLAKNITKEECCC
TVGAAWGDNCETYPCPIPGTVEYQEICPLGKGYIPQEDLLSGKISFTDMDECEIFGSEFC
RNGQCLNTVPGYKCFCRTGYYYDSSRLECVGKMASKSSPRLCRERVTLLMSASLKCCPVP
VHSSGLFPWHPLLVSLTDALEEYEIHLDVCWQTVADYICQDLLHGQQTTYTECCCRFGEA
WGQNCALCPHRSSADFAFLCNGASEDSERGAELRERPRYEYGPGLEDPHYGLPSPYYNYL
ESEYGSPDAGFP
Download sequence
Identical sequences H0ZPH8
ENSTGUP00000012510 ENSTGUP00000012510 59729.ENSTGUP00000012510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]