SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012551 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012551
Domain Number 1 Region: 54-158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-31
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 258-369
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-26
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 3 Region: 449-487
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 164-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 410-448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000117
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 6 Region: 211-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 7 Region: 373-410
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000942
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012551   Gene: ENSTGUG00000012185   Transcript: ENSTGUT00000012690
Sequence length 857
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:136834361:136882814:-1 gene:ENSTGUG00000012185 transcript:ENSTGUT00000012690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPWGSAEGSPAWRSAQLLLLVVSCCGNGALAEHSENVHISGVSTACGDIPEQIRSPSGT
ITSPGWPSEYPARINCSWYIHANPGEIITISFQDFDVQGSRRCSSDWLTIGSYKNIEGYR
ACGSSIPSPYISSQDHVWIRFHSDDSISRKGFRLAYFAGKSDEPSCDCDQFHCANGKCIP
ESWKCNNMDECGDNSDEEICAKANPPTTSSFQPCTNNQFQCLSRFTKLYTCLPESLKCDG
NIDCLDLGDEIDCDVPTCGQWLKYFYGTFSSPNYPDFYPPGSNCTWLIDTGDHRKVILRF
TDFKLDGTGYGDYVKIYDGLEENPRRLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVNA
ARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDETNCTMCQRDEFPCS
RNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGSD
EENCPVIVPTRVITAAVIGSLICGLLLVIALGCTCKLYSLRMFERRSFETHLSRVEAELL
RREAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLENLRLAVRSQLGFTSIRLPMAGRSSN
IWNRIFNFARSRHSGSLALVSADGDDVASQSTNREAERSNTHRSLFSVESDDTDTENERR
DTAGAVGGVAATLPQKVPPATAIEAAVGACGSSSAQGSSSSTTDGGREVTSVEPPSTSPA
RHQLSSALSRMTQGLRWVRFTLGRSSSVNQNQSPLRQLDNGVSGREEDDDVEMLIPVSDV
ASDFDMNDCSRPLLDLSSDQGPGLRQPYSATHHSVRSCSRDGPCESCGIVHTAQIPDTCL
EATVKNETSDDEALLLC
Download sequence
Identical sequences H0ZPL9
XP_012427492.1.42559 ENSTGUP00000012551 59729.ENSTGUP00000012551 ENSTGUP00000012551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]