SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012578 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012578
Domain Number 1 Region: 11-131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000236
Family Growth factor receptor domain 0.0018
Further Details:      
 
Domain Number 2 Region: 113-165
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000249
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012578   Gene: ENSTGUG00000012214   Transcript: ENSTGUT00000012717
Sequence length 212
Comment pep:novel chromosome:taeGut3.2.4:2:138387545:138432124:-1 gene:ENSTGUG00000012214 transcript:ENSTGUT00000012717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANYGPNPICKGCLSCSKDNGCIRCQHKLFFFLRREGMRQYGECLHSCPSGYYGLRTPDMN
RCSRCRIENCDSCFSRDFCTKCKSGFYSHRGRCFRGCPAGFAALEELMECVEGCEVGQWS
EWGTCSRNNKTCGFKWGLETRTRQIVKKPAKDTIPCPTIAESRRCKMAMRHCPGGKWRRP
AKTKDKKKKKKNLMERAQKQHSIFLATDKTSQ
Download sequence
Identical sequences H0ZPP6
59729.ENSTGUP00000012578 ENSTGUP00000012578 ENSTGUP00000012578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]