SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012607 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012607
Domain Number 1 Region: 186-294
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.38e-35
Family Transforming growth factor (TGF)-beta 0.000000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012607   Gene: ENSTGUG00000012237   Transcript: ENSTGUT00000012747
Sequence length 295
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:38667632:38674849:-1 gene:ENSTGUG00000012237 transcript:ENSTGUT00000012747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DELGICPKGVTSNVFRFNVSSAEKNSTNLFRAEFRVLRVPNPSSKRSEQRIELFQILRPD
EHIAKQRYLSGRNVQTRGSPEWLSFDVTETVREWLLHRESNLGLEISIHCPCHTFQPNGD
ILENLHEVLEIKFKGIDSEDDYGRGDLGRLKKQKDLHNPHLILMMLPPHRLESPVLGSQR
KKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTT
HSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Download sequence
Identical sequences A0A091FR72 H0ZPS5
ENSTGUP00000012607 ENSTGUP00000012607 59729.ENSTGUP00000012607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]