SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012652 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012652
Domain Number 1 Region: 483-591
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-34
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 2 Region: 828-948
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-32
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 3 Region: 1006-1114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-32
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 4 Region: 1172-1291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-29
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 5 Region: 303-419
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-28
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 6 Region: 1360-1463
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-28
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 7 Region: 136-245
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-25
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 8 Region: 651-766
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-25
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 
Domain Number 9 Region: 2067-2138
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.51e-21
Family Complement control module/SCR domain 0.0009
Further Details:      
 
Domain Number 10 Region: 1712-1780
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.85e-19
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 11 Region: 2008-2078
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 12 Region: 1769-1837
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.56e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 13 Region: 1951-2019
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 14 Region: 1828-1894
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.98e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 15 Region: 2127-2196
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.7e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 16 Region: 2186-2242
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.09e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 17 Region: 1526-1593
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000128
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 18 Region: 1119-1188
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000139
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 19 Region: 1653-1716
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000375
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 20 Region: 947-1008
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000594
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 2247-2315
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000695
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 22 Region: 1883-1944
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000723
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 23 Region: 423-487
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000445
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 24 Region: 596-661
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000661
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 25 Region: 1464-1537
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000945
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 26 Region: 773-839
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 27 Region: 78-142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000809
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 28 Region: 249-311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000082
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 29 Region: 1598-1660
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000117
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 30 Region: 2306-2364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 31 Region: 1290-1353
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000132
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 32 Region: 2-78
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000131
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012652   Gene: ENSTGUG00000012272   Transcript: ENSTGUT00000012793
Sequence length 2603
Comment pep:novel chromosome:taeGut3.2.4:2:140008636:140229133:-1 gene:ENSTGUG00000012272 transcript:ENSTGUT00000012793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVQFTFYTFHLEDHHDYLLITENGSFTQPLARLTGSELPSPINAGLYGNFRAQLRFISDF
SISYEFNISFSEYNLEPCEDPGIPQFGSRIGFNFGVGDILTFSCSSGYRLEGASEVICLG
GGRRVWSAPLPRCVAECGASTTNNEGILLSPNYPLNYENNHECIYSIQVQAGKGINISAR
TFHLAQGDVLKIYDGKDNTAHLLGAYTGASLRGLTLSSTSNHLWLEFNSDMEGTDEGFQL
VYTSFELSHCEDPGVPQFGYKISDQGHFAGSTIIYGCNPGYTLHGSSLLKCMTGERRAWD
YPLPSCIAECGGRFKGESSGRILSPGYPFPYDNNLRCMWVIEVDPGNIVSLQFLAFDTEA
SHDILRVWDGPPENEMLLKEISGSLIPEGIHSTLNIVTIQFDTDFYISKSGFAIQFSSSV
ATACRDPGVPMNGTRNGDGREPGDTVIFQCDPGYELQGDERITCIQVENRYFWQPNPPVC
IAPCGGNLTGSSGFILSPNFPHPYPHSRDCDWTINVNSDYVISLAFISFSIEPNYDFLYI
YDGPDSNSPLIGSFQDSKLPERIESSSNTMHLAFRSDGSVSFTGFHLEYKAKLRESCFDP
GNIMNGTRLGMDYKLGSTVTYYCDAGYVLQGYSTLTCIMGDDGRPGWNRALPSCHAPCGS
RSTGSEGTVLSPNYPKNYSVGHNCIYSITVPKEFVVFGQFVFFQTSLHDVVEVYDGPALQ
SSLLSSLSGSHSGESLPLSSGNQITVRFTSVGPVTAKGFHFVYQAVPRTSATQCSSVPEP
RFGKRIGNEFAVGSLVLFECNPGYILHGSTAIRCDTVPNALAQWNDSLPTCIVPCGGILT
KRKGTILSPGYPEPYDNNLNCVWKITVPEGAGIQVQVVSFATEHNWDSLDFYDGADNNAP
RLGSYSGTTIPLLLNSTSNNLYLNFQSDISVSAAGFHLEYTAIGLDSCPEPQTPSNGIKI
GDRYMVGDVVSFQCDQGYSLQGHSHITCMPGPVRRWNYPIPICLAQCGGGMSDFSGVILS
PGFPGNYPSSLDCTWTIKLPIGFGVHLQFLNFSTETIHDYLEVRSGSTETSTVIGRLSGP
QLPASLFSTTHETSLYFHSDYSQNKQGFHIVYQAYQLQSCPDPRPFRNGFVIGNDFTVGQ
TISFECFPGYTLIGNSALTCLHGISRNWNHPLPRCEALCGGNITAMNGTIYSPGYPDEYP
NFQDCFWLGRVPPGNGIYINFTVLQTEPIYDFITVWDGPDQTSPQIGQFSGNTALESVYS
TSNQILIKFHSDFTTSGFFVLSYHAYQLRVCQPPANIPNAEILAEDDEFEIGDIIRYQCQ
PGFTLVGNEILTCRLGERLQMDGAPPTCQVLCPANEMRLDSTGVILSPGYPDSYPNLQMC
AWTITVEKGYNISMFFEFFQTEKEFDILEVFDGPNSHSPLLISLSGDYSSSLNITSNGHE
VFLRWSADHGTNKKGFRIRYIALYCSTPESPPHGFIVSQTGGQLNSMVRWACDRGFRLIG
KSTAVCRKSPYGYYSWDVPVPACQAISCGIPKAPLNGGILTTDYLVGTRVTYFCNDGYRL
SAKELTTAVCQPDGTWSNHNKTPRCVVVTCPSINSFTLEHGRWRIVNGSHYEYKTKVVFS
CDPGYYGLGPASIECLANGTWSWRNERPYCQIISCGELPTPPNGNKIGTQITYGSTAIFT
CDSGYMLVGSAVRECLSSGLWRGIETRCLAGHCGIPDLIVNGQVIGENYGYRDTVVYQCS
PGFRLIGSSVRICQQDHNWSGQLPSCVPVSCGHPGSPIYGRTSGNGFNFNDVVTFSCNTG
YVMQGPTKAQCQANRQWSHSPPICKVVNCSDPGIPANSIRESKIEHGNFTYGTVVFYDCN
PGYFLFGSSVLICQPNGHWDKPLPECIMIDCGHPGVPPNAVLSGDKYTFGSTVHYTCTGR
RSLLGQSSRTCQLSGHWSGSLPHCSGDTAGSCGDPGIPGHGSREENNFKIKSTIHFSCDI
GYILHGSEERTCLANGSWTGRQPECKAVQCGNPGTTANGKVLRIDGTTFSNSVIYSCMEG
YILSGSSVRQCTANGTWSGSLPNCTIISCGDPGVPANGMRYGDDYVVGQNVTYMCQPGYT
MEANSSLIRTCTSNGTWSGAIPTCKAVTCPTPPQISNGRLEGTNLDWGFSISYVCSPGYE
LSFPAVLTCVGNGTWSGEVPQCLPKFCGDPGVPAQGKREGKSFIYQSEVSFSCNPPFILV
GSSTRICQADGTWSGSSPRCIEPTRTACENPGVPRHGSQNNTFGYQVGNVVQFQCKKGHL
LHGSTTRTCLPDLTWSGVQPECIPHSCKQPETPSHANVAGMDLPSLGYTLIYTCQPGFFL
AGGSEHRACRSDGTWTGKVPVCEAGSKILVKDPRPALGTPSPKLSVPDDVFAQNYIWKGS
YNYKSKKQPMTLTVTSFNATSGRVNATLTNSNMELLLSGVYKSQEARLMLHIYLIKAPSH
TSASKLKDEKWAMDGFVSAEPDGATYVFQGFIQGKDYGQFGLQRIGLNMSEGSNSSNQPH
GTNSSSVAIAILVPFFALIFAGFGFYLYKQRTAPKTQYTGCSVHENNNGQAAFENPMYDT
NAKSVEGKAVRFDPNLNTVCTMV
Download sequence
Identical sequences H0ZPW9
ENSTGUP00000012652 ENSTGUP00000012652 59729.ENSTGUP00000012652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]