SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012703 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012703
Domain Number 1 Region: 62-140
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.71e-20
Family SAM (sterile alpha motif) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012703   Gene: ENSTGUG00000012339   Transcript: ENSTGUT00000012845
Sequence length 153
Comment pep:known chromosome:taeGut3.2.4:2:142705196:142773665:-1 gene:ENSTGUG00000012339 transcript:ENSTGUT00000012845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFPAIHCNLNPNGIDHPVPTEGINLQLEGERVDSLAVKNTGTPKGPESKDTPKRQVEPEI
SKSGTVKLTKPVALWTQQDVCKWLKKHCPNQYQIYSESFKQHDITGRALLRLTDKKLERM
GIAQESLRQHILQQVLQLKVREEVRNLQLLTQG
Download sequence
Identical sequences H0ZQ19
ENSTGUP00000012703 ENSTGUP00000012703 59729.ENSTGUP00000012703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]