SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012719 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012719
Domain Number 1 Region: 625-924
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-83
Family Protein kinases, catalytic subunit 0.000000000725
Further Details:      
 
Domain Number 2 Region: 32-204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-74
Family Ephrin receptor ligand binding domain 0.000000833
Further Details:      
 
Domain Number 3 Region: 331-537
Classification Level Classification E-value
Superfamily Fibronectin type III 5.26e-42
Family Fibronectin type III 0.0000739
Further Details:      
 
Domain Number 4 Region: 919-994
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.59e-22
Family SAM (sterile alpha motif) domain 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012719
Domain Number - Region: 260-322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000115
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012719   Gene: ENSTGUG00000012333   Transcript: ENSTGUT00000012862
Sequence length 997
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:76169612:76318347:1 gene:ENSTGUG00000012333 transcript:ENSTGUT00000012862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQSRLPSWIILCSVWLFRFAHTGEAQAAKEVILLDSKAQQTELEWISSPPNGWEEISG
LDENYTPIRTYQVCQVMESNQNNWLRTNWIAKSNAQRIFVELKFTLRDCNSLPGVLGTCK
ETFNLYYYETDYDTGRNIRENQYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKK
GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE
EAENSPKMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHS
FSDKEGSSRCDCEDSYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGR
SDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLVDNYVTVMDLLAHANYTFEVEAVNG
VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKY
YEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATG
KELATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHFK
FPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVA
VAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEYMENGALDA
FLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSR
VIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMS
NQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERGERPKFEQIVGILDKMIRNPNSLK
TPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIE
DVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV
Download sequence
Identical sequences H0ZQ33
ENSTGUP00000012719 ENSTGUP00000012719 59729.ENSTGUP00000012719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]