SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012725 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012725
Domain Number 1 Region: 3-118,149-201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.52e-26
Family Laminin G-like module 0.000000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012725   Gene: ENSTGUG00000012363   Transcript: ENSTGUT00000012869
Sequence length 251
Comment pep:novel chromosome:taeGut3.2.4:5:40581848:40719576:1 gene:ENSTGUG00000012363 transcript:ENSTGUT00000012869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGATYIFGKSGGLILYTWPANDRPSTRTDRLAVGFSTTVKDGILVRIDSAPGLGDFLQLH
IEQGKIGVVFNIGTVDISIKEESTPVNDGKYHVVRFTRNGGNATLQVDSWPVNEHYPTGN
TDSERFQMVKQKIPFKYNRPVEEWLQEKGRQLTIFNTQAQIAIGGKDRGRLFQGQLSGLY
YNGLKVLNMAAENNPNIKINGSVRLVGEVPSILGTTPTTSVPPEMSTTVMETTTTMATTT
TRKNRSPPSIQ
Download sequence
Identical sequences H0ZQ39
59729.ENSTGUP00000012725 ENSTGUP00000012725 ENSTGUP00000012725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]