SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012743 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012743
Domain Number 1 Region: 597-946
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1e-92
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000369
Further Details:      
 
Domain Number 2 Region: 406-593
Classification Level Classification E-value
Superfamily ARM repeat 4.22e-48
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00069
Further Details:      
 
Domain Number 3 Region: 990-1086
Classification Level Classification E-value
Superfamily PX domain 3.14e-17
Family PX domain 0.0038
Further Details:      
 
Domain Number 4 Region: 1108-1216
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000102
Family Synaptotagmin-like (S variant) 0.015
Further Details:      
 
Domain Number 5 Region: 311-402
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000203
Family PLC-like (P variant) 0.045
Further Details:      
 
Domain Number 6 Region: 6-151
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000119
Family Ras-binding domain, RBD 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012743   Gene: ENSTGUG00000012374   Transcript: ENSTGUT00000012887
Sequence length 1219
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:68118050:68314409:-1 gene:ENSTGUG00000012374 transcript:ENSTGUT00000012887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWAIQLIEADQGSNENTVDFCNAVEKIRNAYPAFDLKTNTGKIWSITTRFPEHILGATKF
RLSIWTDFSPHPLLLTQHAGCIIHDLIVEILRCTNQYPAREEECLLSVAGSDEFLQNNCT
LGSHESLRKASTCIQLRLHHAGNLEHSLARTCGDDQRRFCVNELLEDTHAWRLIWQNLVS
VIMNYRGQVEYLLQNEQNNVDNVIEAAKAICSVLCFVETRDITDAVSKLHALGRAQVKDA
CSCPTVIFKTLIEAAVTELSMAISRLIRIYSSSFDVNFQLASVPRSPLCADISLNSQLSF
TVCAAHNIPEAWVTRVNFPLRIKALPRETMLTIKLLGLNSASKNTEVLAWTCSPLYAKER
LIRGTVLLSLAPCSTLPTAVITPGICSTEAPTSATLQIDFPETDLKFIKPEPEERRGDFV
EPTQECLKNIARLSQKHSLLLLSEQQRRILWFYRYSCNNQNCSLPLVLGSAPSWDRTTVS
EMYALLRGWRFSDPLEALGLLTFSFPDQDIRRAAVQQMENVSNDELLEYLPQLVQVLKFE
WTLESPLVKLLLNRSLQSIQVAHQLYWLLKNAQNEVHFRMWYKKLLAALQFCAGQTLNNE
FSKEEKLIRILEDIATKVKAASDPKRKEVLKVELSRLQQFFQEVKLCRLPLNPALVVQGI
EADSCSYFTSNAFPLKISFINANAPSGNINVIFKIGDDLRQDMLVLQIIRLMDSIWLQEG
LDMQMIVYRCLSTGKGQGLVQMVPDATTLAKIHRESGLIGPLKENTIKKWFHHHHPLESS
YQEAIRNFFYSCAGWCVVTFILGVCDRHSDNIMLTKAGHMFHIDFGRFLGHAQMFGNIRR
DRAPFIFTSEMEYFITEGGKNPQRFQEFVELCCRAYNIVRKHSQLLLNLLEMMLHAGLPE
LNSIQDLKYVYDNLRPQDSDLQATSYFTRKIKESLECFPVKLNNLIHTLVQMSVGSSAKP
PAPETVPQEWTVLDTERSIARATILGFSRKPDSVYLIQVVQTCNVVTFVEKSFHQFSKLH
SHLQKQFPSHALPEFPHSWHLPFTDLEHKRVKDLNLYLKQLLSGSRKLANNELVLSFFLN
WSKNTLAEHSSSLTLGPQSAGHKPGVQLVISYENTRLTIMLKHMRNLHLPDGSAPSAHAE
FYLLPDPCEVSRRKTRTAPKGSDPTYNELIVYDRVSELQGRVLKLVVKSKGTFVGAVNIQ
LSSVQLNEEKWYPLGNSVI
Download sequence
Identical sequences H0ZQ57
ENSTGUP00000012743 59729.ENSTGUP00000012743 ENSTGUP00000012743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]