SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012761 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012761
Domain Number 1 Region: 13-313
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.66e-46
Family beta-glycanases 0.025
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012761
Domain Number - Region: 511-625
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00428
Family Laminin G-like module 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012761   Gene: ENSTGUG00000012397   Transcript: ENSTGUT00000012906
Sequence length 640
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:43579329:43607771:-1 gene:ENSTGUG00000012397 transcript:ENSTGUT00000012906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVLDDANGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEI
GGDAQSTDGTEPSHMHYENDENYFRGYEWWLMKEAKKRNPNIKLIGLPWAFPGWIGKGEN
WPYDYPDITAYYIISWILGAKQYHDLDIDYVGIWNERAFSSKYIKLLRYTLDKHGLEQVR
IIASDRLWEPISFVMMIDSELHGVVDVIGAHYPGTKTVQNAILTGKKLWSSEDYSTFNDD
VGAGCWARILNQNYVNGNMTSTIAWNLVASYYEELPFGRCGLMTAQEPWSGHYKVESPIW
ITAHTTQFTQPGWSYLQVDGHLEGGGSFVALTDGLGNLTIIIETMSHNHSKCIRPPLPNF
NVMPQRATFYLRGSFQEVNSLQCWSLFHTWQSFVNFCSLSFLQFQVWEGRFSLDLNVDEV
YTLTTLKTGRKCGCPEPPPPQPFPSNYNDDFNIRNPPFSEAPNFADQTGVFEYFVNASDP
GDHVFTLRQVVVQRPITWVSDADQTISVIGNFKWVNMTVTCDIYIEKPRDGGVFIAGRVD
NGGIYVRHSKGVFFWVFADGTYRVTGDLAGKQILMKGLAGVRDNAWHTLTLNIQGNSASG
LLNGYPLWDNVTVSSPGNGWAALGTRSFEFAQFDNFHVEA
Download sequence
Identical sequences H0ZQ74
ENSTGUP00000012761 59729.ENSTGUP00000012761 ENSTGUP00000012761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]