SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012770 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012770
Domain Number 1 Region: 61-187
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-52
Family Phosphotyrosine-binding domain (PTB) 0.0000727
Further Details:      
 
Domain Number 2 Region: 534-591
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000441
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 727-782
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000628
Family Pointed domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012770
Domain Number - Region: 230-268
Classification Level Classification E-value
Superfamily GreA transcript cleavage protein, N-terminal domain 0.0798
Family GreA transcript cleavage protein, N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012770   Gene: ENSTGUG00000012399   Transcript: ENSTGUT00000012915
Sequence length 823
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:69276413:69325964:1 gene:ENSTGUG00000012399 transcript:ENSTGUT00000012915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGHISNTPPGGYGSYFPQMNGYGSPTFAQAEREQNSRTSAKALYEQRKNYARDSVSSIS
ETSQYHVEHLTTFVLDRKEAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDKAVSLVDLE
SKNELENFPLSTIQHCQAVMNACNYNSILALICKEPTQNKPDLHLFQCDEIKATLIHEDI
ESAISDSKSGKQKKRLETLRMISKADSAIPPPPRAPAPVPPGTITQVDVRSRVAAWSAWA
SEQGDYEKHRQYHEQEETAEMIAARIDRDVQILNHILDDIEYFVTKLQKAAEAFAELSKR
KKTKKSKKKGPGEGVLTLRAKPPPPDEFVDCFQKFKHGFNLLAKLKFHIQNPSAADLVHF
LFTPLHMVVQTTGGPELASTVLSPLLTKDTIDFLRYTVTSEEGQLWMSLGDSWTKARAEW
PKDHFIPPYVPRFRNGWEPPLLNFMGAPKEQELNHLAESVANVAEQQRKQEMKRLSSEPP
GVPDYPPADGYAFSNTVYKRGPLLDQGAAVAAFKQTVSRHVDRNYEAHNKAQTKKYAKCK
YEFVARNNSELSVMKEEIVEILDDRKQWWKVQNKSGSTGFVPNNILDPLRSAEGGQGWPE
PAYTRTIQKQRMDYVAKQPDPAPATPSPPPTPAPVPVAVPGSPIPVPVPKAPAAVSRQSS
TSSDSGGSVARDAQRQKQIPVDRRKSQMEEVQDELVHRLTIGRSAAQRKFHVPRPNIPVV
NITYDSSPEDVKAWLQSKGFNPVTVNSLGVLTGAQLFSLNKEELRTVCPEGSRVYNQITV
QKSALEASSGSSELQEIMRRRQEKISAAATDSGVESFDEGSSH
Download sequence
Identical sequences H0ZQ83
ENSTGUP00000012770 59729.ENSTGUP00000012770 ENSTGUP00000012770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]