SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012777 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012777
Domain Number 1 Region: 875-1175
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.98e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000973
Further Details:      
 
Domain Number 2 Region: 215-358
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-34
Family Third domain of FERM 0.0014
Further Details:      
 
Domain Number 3 Region: 107-213
Classification Level Classification E-value
Superfamily Second domain of FERM 1.07e-29
Family Second domain of FERM 0.00036
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.51e-18
Family First domain of FERM 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012777   Gene: ENSTGUG00000012408   Transcript: ENSTGUT00000012922
Sequence length 1179
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:43795294:43829989:-1 gene:ENSTGUG00000012408 transcript:ENSTGUT00000012922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
ITYFSLWYYNKQNQRRWVDLDKPLKKQLDKYASEPTVYFGVVFYVPTVSQLQQEITRYQY
YLQLKKDILEGNIPCTLEQAIHLAGLAVQADFGDYDQYESQEFLQRYALFPVGWLQEEKI
LEEATQKVALLHQKYRGLTPPDAEMLYMQEVERMEGYGEETYPAKDSQGSDIFIGACLDG
IFVKHKNGRPPVVFRWHDIANMSHNKSFFALELANKEETIQFQTEDMETAKYVWRMCVAR
HKFYRLNKCSLQTQPVTVNPVRRRSSSRMSMPKPQPYMMPPPPQLHYNGHYSEPYATSQD
NLFVSNQNGYYCHSQTSLDRTPHDYSGRIRNGSVYSAHSTNSLNNPQHYLQPSPMSSNPS
ITGSDVLRTDYVPSHRHSALIPPSYRPTPDYETVMRQLNRGMVHTDRQSHSMRNLNISNS
YAYSRPDALVYSQPEIREHAHFAAPQSNHYPFNLNYSFHSQSPYPYPAEKRPVVGAVSVP
ELTNVQLQSQDYPAPNIMKTQVYRPPPPYPYPRPANSTPDLSRHIYISSSNPDLITRRVH
HSVQTFQEDSLPVAHSLQEVSEPLTSARHAQLQKRNSIEIAGLTPSFEGIRIKERTMSAS
AADVALPRVISEGSQPNILMERVKQKEAEQEECVNCDHKKTLSDATMLIHSSEEEEEFEE
ENKASTSLSPLPEDQTQLSSVMGVLNYPYSSVASSAGPLHILEPKLHITEAEKRMKDMSP
VHLLVESQVQRRGEGLLTPSMSESDLTTSGRYRVRKDSVKKRPVSDLLSGKKNIVEGLPP
LGGMKKNKNDAKKMGPLKLAALNGLALTRMPLPDEGKEEPTRATNDERCRTLEQRLEQGM
VFTEYERIQKKRLMDGECSIARLPENAERNRFQDVLPYDDTRVELVPTKENNTGYINASH
IKISIGGIEWDYIATQGPLQNTCQDFWQMIWEQGIAIIAMVTAEEESGREKSFRYWPRLG
SRHNTVTYGRFKITTRFRTDSGCYATTGLKIKHLLTGQERTVWHLQYTDWPEHGCPEDLK
GFLSYLEEIQSVRRHTNSTAEPKSANPPLLVHCSAGVGRTGVVILAEIMIACLEHNEMLD
IPRVLDMLRQQRMMMVQTLSQYTFVYGVLIQFLKSSRLI
Download sequence
Identical sequences H0ZQ90
59729.ENSTGUP00000012777 ENSTGUP00000012777 ENSTGUP00000012777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]