SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012815 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012815
Domain Number 1 Region: 441-567
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-30
Family Cadherin 0.0018
Further Details:      
 
Domain Number 2 Region: 220-343
Classification Level Classification E-value
Superfamily Cadherin-like 1.93e-29
Family Cadherin 0.0016
Further Details:      
 
Domain Number 3 Region: 117-224
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-23
Family Cadherin 0.0023
Further Details:      
 
Domain Number 4 Region: 333-445
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-20
Family Cadherin 0.0034
Further Details:      
 
Domain Number 5 Region: 557-663
Classification Level Classification E-value
Superfamily Cadherin-like 7.2e-18
Family Cadherin 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012815   Gene: ENSTGUG00000012453   Transcript: ENSTGUT00000012961
Sequence length 994
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:59795491:59799291:-1 gene:ENSTGUG00000012453 transcript:ENSTGUT00000012961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLRLLAAACLLALSRCKTVRYRTDEEGAPGTVIGTLADEMPVKAPGEMSFRLMRQFSNSS
LVRVREEDGQLSIGEAGLDRERLCGQTPQCVLAFDVVSCWRERYRLVHVELEVRDINDNA
PRFPHAQMALEISESAAPGTRLPLEVAVDEDVGSNSIQSFQVSLNSHFGVEAQTRADGAR
CADLVLLQELDRERQPSYTLELVAKDGGSPARSGTATVHVRVLDANDNSPTFAQSSVTVE
LPEDAPPGSLLLDLDAADPDEGPNGEVVYAFSSQVPPEARRLFRLDPRSGHLTLEAAVDY
ERTRTYELDVRAQDRGASPRAATCTVVVRLTDVNDNAPRISISALRGAASAAGVAYVSEA
AATESFVALVSATDRDSGANGQVRCSLRGHDHFALQRAYEDSYMIVTTAALDRERIPEYN
LSVLAEDLGSPPFKTVRQYTVRVSDENDNAPLFAKPLYEVAVPENNPPGAYITTVVARDP
DLGHNGKVTYRLLETQVMGAPISTYVSVDPATGAIYALRTFNYEILKQLDLRIQATDGGS
PQLSSSTVVKVRMVDQNDNPPVIIHPVLTNGTVEIGVSSKTTRDSLVAQIKARDADDGAN
AELTFAFLEESQQDLFTINPSSGDIVLRGDLSEELGQLFKVILTVTDNGRPPLATTATVN
FLVTATAPSSIQDIAKPSSWEGKALQWDIPLIVIIVLAGSCTLLLVAIITIATTCNRRKK
GNLKNNAALKDQIDISHLEKGHQEEGSQRGNIFEVRTFPSKASFTSPDPSPATEEIATTE
SGSDSTCLYEGQKRLRGQSGEGFAAAPSYNKEPAPPVAIWKGHSFNTISGREAEKFSGKD
SGKGDSDFNDSDSDISGDALKKDLITHMQNGLWACTAECKILGHSDRCWSPSCGRANPHP
SPYPSAPLSTFCKSTSLPRDPLRRDNFYQAQLPKTVGLQSVYEKVLHRDFDRTITLLSPP
RPARLPDLQEIGVPLFPAPSTRYLGPQTETTEKA
Download sequence
Identical sequences H0ZQC7
ENSTGUP00000012815 59729.ENSTGUP00000012815 ENSTGUP00000012815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]